Loading...
HomeMy WebLinkAboutAgenda 1998 09-21AG E N DA NE`V HANOVER COUNTY BOARD OF COMMISSIONERS Assembly Room, New Hanover Coznrty Courthouse =~~~pKOVee c~Gy~ ~ 2-~ North Third Street, Room 301. •, } ^. Wilmington, 1VC • , ` 7l ~.~ o`• WILLIAM A. CASTER CHAIRMAN ROBERT G. GREER VICE-CHAIRMAN . _ ~~FNORTNL~Q '.BUZZ BIRZENIEKS, COMMISSIONER TED DAVIS, JR., COMMISSIONER' • CHARLES R. HOWELL, COMMISSIONER - - ~ ~ - ~ ALLEN O'NEAL. COUNTYMANAGER WANDA M. COPLEY, COUNTY ATTORNEY • LUCIE F. HARAELL, CLERK TO THE BOARD - - September 21, 1998 ' MEETING CALLED TO ORDER (Chairman William A. Caster) 4 ~ INVOCATION' `, ', PLEDGE OF ALLEGIANCE - NON-AGENDA ITEMS (Limit three minutes per item) -~ APPROVAL OF CONSENT AGENDA . , ,ESTIMATED ITEMS $USINESS . PAGE TIMES .IVO. °~ ' 9:15 am .~ 1. Recognition of New Employees 1 . ° , 9:25 a.m. 2. Presentation of New Hanover County .Service Awards ~. J 9:35 a.rn,~ 3. Consideration of Approval of New Hanover Regional Medical Center $ " ' ° ~ Refinancing Resolution ~,; ~ ~ 9:SS a.m. -4. ~ Consideration of Falcon Cable Report and Corrective Action Plan 9 - _ 10:45 a.m. S. Consideration of Approval of Pilot's Ridge Park/School Master Plan 15 .. ~. I0:55 a.m. 6.. Consideration of Design/Engineering Cost Allocation Arrangement 1 ~ ` ~ for N.E.' Branch Library and a Letter of Support for a' Naming Opportunity. 11.:10 a.m: ~7. .Consideration of Funding Request for Community Development ~ - 19 Corporation'for aBusiness Incubator Program .. 11:40 a.m. 8.. Committee Appointments ~ 23 _ 12:0 p.m._ 9. ,Meeting of the Water and Sewer District - .. ~ 133 -ADDITIONAL-ITEMS ~ ~ . . - County Commissioners ' County Attorney . . ,County Manager CONSENT. AGENDA' _~ NEW HANOVER COUNTY BOARD OF COMMISSIONERS ~-~ " SEPTEMBER 21; 1998 ITEMS OF BUSINESS -PAGE - :. NO. 1. Approval of Minutes 145 2. Approval of Release of Value, .:. ~ - . , 147 3. Approval of New Hanover County and New Hanover :County Fire District 149 Collection Reports 4. Approval of award of Bid #99-0039 and approval of contract #99-0039 for 153 sulfuric acid for the WASTEC facility of the Environmental Management Department 5. Approval of Budget Amendment #99-0027 to rollover unexpended grant 179 funds from FY 97-98 to FY 98-99 6. Approval of Resolution requesting to add Strata and Callie Streets to the 185 State Highway System 7. Approval of Proclamation declaring Saturday, September 26, 19.98 as 189 Hunting and Fishing Day in New Hanover County 8. Approval of Electronic Benefits Transfer -Customer Training at DSS 193 ~~fRfi i~`~$i~~ ~~~~+~ ~~Y~~ ~~~.4ey:la ~«.4~ q aa `~B~Yi T ~6~~ t,R~~"lri~ 2 _ ~$ ~ ra .. f NEW HANOVER COUNTY BOARD OF COMt1111SSIONERS _ REQUEST FOR BOARD ACTION -• `.:. Meeting Date: 09/21/98. . _ Regular ltem #: 2 Estimated Time: Page Number; Deparfinent; Human Resources Presenter: Allen O'Neal ~ ' .. ..., , • Contact: Rosetta Bryant - - ~ ~ SUBJECT: ' - Presentation of New Hanover County Service Awards • ' BRIEF SUMMARY: . The following employees are entifled to New Hanover County Service Awards due to their length of service with New Hanover County: FIVE (5) YEAR: Norma Troutman -Budget; Andrew W. Olsen -Legal Dept.; Annie J. Britt -Sheriffs Dept.; David MacAlpirie -Sheriff's Dept.; William N. Lewis -Parks; John Norton -Parks; TEN (1D) YEAR: Cari Sullivan -Environmental Management; Phyllis A. Clemrnons • Social Services; Mary M. Coulson -Social Services; FIFTEEN (15) YEAR: Roland G. Register -Tax Dept.; Bettejean Anderson -Social Services; Faye H. Smith -Social Services; and TWENTY (20) YEAR: Janet K. Seapker. • RECOMMENDED MOTION AND REQUESTED ACTIONS: f=UNDfNG_SOURCE: -, -: ATTACHMENTS: . ITEM DOES~NOT REQUIRE REVIEW ' COt1NTY MANAGI=R' MMENTS AND RECOMMENDATIONS: `: Present awards.. COMMISSIONERS' ACTIONS/COMMENTS: ~ ' ., M COUNTY ~oM~ls~i+ ' APP~tOVED G~' .. REJECTED tJ • ~ :, ~ REMOVED Q .. _ FOSTPt3i~lEU t~ .. .• _ MEARd .. 9 a. y ~?A~'Ir 3~ - .~ ~~~ ~ ~ ~ ~~ NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION Meeting Date: 09/21/98 . Regular Item #: 3 Estimated Time: Page Number: Department: Finance Presenter: Bruce Shell or Warida Copley Contact: Bruce Shell SUBJECT: New Hanover Regional Medical Center Financing Resolution BRIEF SUMMARY: The Local Government Commission requires a Findings Resolution approved by the Board of County Commissioners. The resolution expresses the County's interest in obtaining revenue bond financing for the purchase of Cape Fear Memorial Hospital. ~ RECOMMENDED MOTION AND REQUESTED ACTIONS: Adopt resolution. FUNDING SOURCE: ATTACHMENTS: ,... . .- .. .. REVIEWED BY: ,:.. ;,_. . LEGAL: Approve FINANCE: BUDGET: N/A HUMAN RESOURCES: N/A COUNTY MANAGER'S COMMENTS AND RECOMMENDATIONS: Recommend approval of resolution. Note: The resolution will be distrib t d r separate cover. COMMISSIONERS' ACTIONS/COMMENTS: AUNTY COMMISSION . APPROVED G/ RF.~ECTEO D . REMOVED i~OSTPQNI~ t~ HEARQ ~,i !?ATa~ .,~...~',~,!„ EXTRACTS FROM MINUTES OF BOARD OF COMMISSIONERS A meeting of the Board of Commissioners for the County of New Hanover, North Carolina, was held in the New Hanover County Courthouse, 24 North Third Street, Room 301, Wilmington, North Carolina, at _.M. on September 21, 1998. . Present: Absent: ~ - Also present: • ~ .. • - * * ~ ~, introduced the following resolution, which was read by title: - • "PRELIMINARY RESOLUTIONS RELATING TO REVENUE BOND ISSUE FOR NEW IIANOVER REGIONAL MEDICAL CENTER" WHEREAS, the Board of Commissioners wants to adopt certain preliminary resolutions relating to its later issuance of Hospital Revenue Bonds (New Hanover Regional Medical Center Project) Series 1998 (the "Bonds"); NOW, THEREFORE, BE IT ORDERED by the Board of Commissioners as follows: ~+^~f~~~~ 1~P~3~~ 1. The Couii~ty Maragert~and the Finance Officer are each appointed as representa- tives to file an applicationlito the~rLocal~Government Commission relating to the Bonds. Robinson, Bradshaw & I3inson~Po?A~"is designated to serve as bond counsel for the issuance of the Bonds. ~ EfJ~~i + ~$ ''• ~ ~~' 1 38889v01!.13704.00013 2. The Board of Commissioners requests the Local Government Commission to sell the Bonds at private sale without advertisement to any purchaser or purchasers thereof, at such prices as the Local Government.Commission determines to be in the best interest of the County, subject to approval of the Board of Commissioners or designees thereof. 3. The proceeds from the sale of the Bonds will be used to repay debt incurred by New Hanover Regional Medical Center to acquire the assets of Cape Fear Hospital and to pay certain costs of issuing the Bonds, and the Board determines that project and purpose is necessary and beneficial. , 4. The Board of Commissioners makes the following findings: (a) Issuance of the Bonds is necessary or expedient. (b) The amount of the Bonds will be sufficient but is not excessive for the proposed purposes. (c) The proposed project is feasible. (d) The County's debt management procedures and policies are good.. (e) The Bonds can be marketed at a reasonable interest cost to the County. .. . ,. - -: The motion having been duly seconded, and the resolution having been considered; it was adopted by the following vote: AYES: NAYS • C-538809x01!.13704.00013 2 7 ..~ STATE OF NORTH CAROLINA ) . . . ss.. COUNTY OF NEW HANOVER ) I, LUCIE F. HARRELL, Clerk to the Board of Commissioners of the County of New Hanover, DO HEREBY CERTIFY as follows: . - . 1. A meeting of the Board of Commissioners of the County of New Hanover, located in the State of North Carolina, was duly held September 21, 1998, such meeting having been ;~ noticed, held and conducted in accordance with all requirements of law (including open meetings requirements), and minutes of that meeting have been duly recorded in the Minute Book kept by me in accordance with law for the purpose of recording the minutes of the Board. 2. I have compared the attached extract with the minutes so recorded and the extract is a true copy of those minutes and of the whole thereof insofar as those minutes relate to matters .... _ ... referred to=iri fhe extract. ~ ~- 3. That extract correctly states the time when the meeting was convened and the place where the meeting was held and the members of the Board who attended the meeting. IN WITNESS WHEREOF, I have hereunto set my hand and have hereunto affixed the seal of the County on , 1998. (SEAL) Clerk to the Board of Commissioners 3 ~38889v01!.13704.0001J .- NEW HANOVER COUNTY BOARD OF COMMISSIONERS - ~ REQUEST FOR BOARD ACTION Meeting Date: 09/21/98. Regular Item #: 4 Estimated Time: Page Number: Department: Legal Presenter: Wanda M. Copley, County Attomey Contact: Wanda M. Copley, County Attorney SUBJECT: falcon Cable BRIEF SUMMARY: Due to numerous complaints of deficiencies from Falcon customers, the County felt it had an obligation to determine the deficiencies that have not been corrected. The County's cable consultant has done a thorough investigation of the deficiencies and has set out its findings in the report made available to the Commissioners. RECOMMENDED MOTION AND REQUESTED ACTIONS• ' Adopt Order that requires Falcon Cable to correct the deficiencies within sixty ~(60) days and present to the County that the deficiencies set out in the report have been corrected and that the cable system complies with the FCC signal quality standards. Falcon must come into compliance within sixty (60) days after the. issuance of the Order, or the County will take action against Falcon. FUNDING SOURCE• - . ATTACHMENTS: REVI>=WED BY: LEGAL: Approve FINANCE: N/A BUDGET: N/A HUMAN RESOURCES: N/A COUNTY MANAGER'S COMMENTS AND RECOMMENDATIONS: - ConsiderAdoption Order for Falcon Cable and the corrective action plan. COMMISSIONERS' ACTIONS/COMMENTS• . ~p'i~ROV~p ~tEjEC"TRw.n ~ aEMOV~a posTpoNEt3 fl H~ARQ ~ ~~~~' 9 STATE OF NORTH CAROLINA COITNTY OF NEW HA.NOVER BEFORE THE COUNTY OF NEW HANOVER . IN THE MATTER OF: ) NOTICE OF ~ - Review and Recommendations of ~ ) NON-COMPLIANCE Technical Audit Report of ) WITH FCC TECHNICAL Falcon Cable Media's Cable ) STANDARDS AND .Distribution System servingNew ~ ) 60 DAYS TO CURE Hanover County, North Carolina, ~ ~ . _ NC-0152 WHEREAS, on August 6 and 7 1998, consultants for the,County conducted a technical audit of Falcon Cable Media's cable distribution system serving unincorporated areas of New Hanover County, performing a computer analysis of cable signals at 37 test locations, and visually inspecting over 209 road-miles of cable plant; _. WHEREAS, 17 test sites, 1, 2, 3, 7, 14; 18, 20, 21, 23, 24; 26, 30, 32; 34, 35, 36, 37, failed the` FCC minimum visual carrier level (All CH>) standard on one or more channels; ~ ~ ~ ' WHEREAS, 26 test sites, 1, 2, 4, 5, 6, 7, 9, 10, 11, 12, 13, 15, 16, 17, 18, 19, 25, 26, 27, 28, 29, 30, 31, 33, 36, 37, failed the Industry maximum visual carrier level.(Al1 CH <) standard on one or more channels; WHEREAS, 9 test sites, 1, 2, 7, 12, 21, 25, 30, 31, 36, failed the FCC all-channel visual carrier separation level (All CH) standard;- WHEREAS, 9 test sites, 2, 19, 22, 23, 24, 25, 36, 37; failed the FCC maximum Hum level standard on one or more channels; WHEREAS, all 37 test sites failed the FCC maximum aural carrier level (Max A!V) standard on one or more chan~ne;ls~ ~~9?~ y WHEREAS 3 test sites 2~~29~}~°' ~-1A~ailed the FCC minimum aural carrier level (Min A/V) standard on one or more c'h' annels'R'~,~(~~ WHEREAS, all 37 test~si~e ~failed~'~he FCC adjacent-channel visual carver level CH-C standard on one or~'.~m. Dore c~hannels"N ( ~ ~r~~ 10 C WHEREAS, 27 test sites, 1, 2, 3, 5, 6, 7, 10, 13, 14, 15, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 30, 32, 34, 35, 36, 37, faded the FCC carrier-to-noise ratio standard on one or more channels; WHEREAS, 7 test sites, 1, 2, 7, 12, 21, 30, 36, exceeded 10 dB in system Tilt; WHEREAS, 7 test sites, 1, 2, 3, 4, 8, 31, 37, failed the FCC Peak-to-Valley standard of less than 1 o dB; . WHEREAS, 4 houses in new subdivisions inspected by the consultants have 8-port, 11 dB splitters attached to them; WHEREAS, the outputs of 8-port splitters are 11 dB less than the input to the sputter and decrease the signal level by 11 dB present at the subscriber's terminal; WHEREAS, not all of the outputs of said splitters were in use, connected to cables, or properly terminated; WHEREAS, Center conductors on cable heads at several test sites were corroded anal discolored, such as Site 14, 7103 Grouper Ct; WHEREAS, the threads of many cable connectors were not coated with a protective agent (e.g., . Vaseline) to guard against salt-air corrosion, such as 1812 Canal Street; ., ... ...: WHEREAS, an unburned cable drop lying across a road was observed at 6131 Indian Cove Ave; WHEREAS, an improperly burned cable drop was observed at 6218 Spring Oaks Mobile Home Park, unit 9B; and, WHEREAS, it is reasonable to infer that the deficiencies observed at the 37 sites visited by the consultants exist at the residences of other cable subscribers. TT IS THEREFORE ORDERED: THAT, Falcon Cable Media is in violation of FCC technical standards as set out in 47 C.F.R. Subpart K, § 76.605; THAT, Falcon Cable Media shall correct within 60 days from the date this executed order is mailed the deficiencies identified in the Findings of Fact in this report; THAT, Falcon shall bury all unhurried cable drops that should be hurried, and shall properly bury all improperly burned cable drops, shall clean all corrosion from the center conductors of cable drops, shall apply appropriate corrosion resistant material to cable connectors, shall use signal sputters with appropriate attenuation to ensure that the cable signal level present at the subscriber's terminal meets the 'FCC technical'standards of no less than 0 dBmV; 11 THAT, Falcon.,Cable Media shall ensure that within 60 days from the rriailing of this executed order the cable television signals received by all subscribers in unincorporated New Hanover County, franchise NC-0152 fully comply with all technical standards set out in 47 C.F.R. Subpart K, and all other applicable laws and ordinances; and, THAT, Falcon Cable Media shall submit in writing to New Hanover County Commissioners within five (5) days after the expiration of the 60-day period a report identifying with detail the corrective action taken in order to comply with the terms of this order. ISSUED BY ORDER OF THE COUNTY OF NEW HANOVER This the ~ day of , 1998. ATTEST: By; . ... `: Clerk to the Board Chairman County .Commissioners ' seal . _ a. ~.~ . Deliver via Certified U.S. Mail to: Falcon Cable Media File copy to: Robert F. Sepe, Action Audits •~ ~.~.. 12 CERTIFICATE OF SERVICE . This is to certify that the foregoing document tlus day has been served upon the following by depositing . same in the. United States mail, postage prepaid, and addressed as follows: Michael Singpiel Division Vice President Falcon Cable Media Pleasure Island Plaza B-2 Carolina Beach, N.C. 28428 -910-480-3275 This the day of • 1998. Becky Howell Administrative Assistant Office of County Attorney 320 Chestnut Street, Suite 309 Wilmington, N. C. 28401 .... ... 10-341-743 8. 13 i ~1- . a : ~. ~ .. This page intentionally left blank . 14 NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION ~~ Meeting Date: 09/21/98 Regular Item #: 5 Estimated Time: Page Number. Department: Parks Presenter: Paul Boney, Boney Architects Contact: Neal Lewis SUBJECT: Pilot's Ridge Park/School Master Plan BRIEF SUMMARY: Paul Boney, of Boney Architects, will present the final conceptual Master Plan for the Pilot's Ridge Park/School site for Board approval. Parks & Recreation Advisory Board has approved the conceptual Master Plan. Details of specific facilities are yet to be finalized. RECOMMENDED MOTION. AND REQUESTED ACTIONS: Board approval of the conceptual Master Plan .Authorize Mr. Boney to proceed with schematic plans, cost estimates and recommended phasing of development. FUNDING SOURCE: N/A ATTACHMENTS: _. . REVIEWED BY: .~ LEGAL: N/A FINANCE: N/A BUDGET: N/A HUMAN RESOURCES: N/A COUNTY MANAGER'S COMMENTS AND RECOMMENDATIONS: Consider approval of the conceptual Master Plan. The Park dviso and has~approved the - conceptual Master Plan. Paul Boney will make a presentation. COMMISSIONERS' ACTIONS/COMMENTS: i t f;~UNt"Y COMMi~I~Il ~tQ~ROVED REJECTED Ca - REMOVEp C~ PQSTPON~~ ~1 1~ m c ~ Y ~ ~ m a C O C . O _~~ rv^`' O_ N W O ~' s ~ Q N ~ C = . ~J' c m cii din ~a~ o~~~ 3 O):- Y U .D O 7 .. >. c U U RS ~ y~ Qa ~ U~ d ~v ~ O_co a~ o a~>>- a~ ~ U ~ - aaOF`m~mcncn¢c~LL.cn~ ZO~OCLCn1=~>~X1-NQ _ _ ~ c ~ _ s, _ Y - • • w s • Y` ~ • .. Cn ~ O .D Y O O E .~ .. ti _ ~" 'rig.- !Y:'i'--~' '~ v _ U 'cJ aL p c0 "sCtierr. ~ . • _.... ~:,, . ~ FFl ~ ,r:x ~ ., .. • w ` ~•r . _ .. - •. r. r~..~ . ~' 22 r ~~ :;~ . ~ •a ~ . " ~.- = 7 l: .. ~,: •~. ,<_ -- . • K. •• . Jam.., {'.., .• r ~' .... : . ~:= :mss .: .. *_~_ : ~ : -. ` Z. . .r .• • ~.1 c' ~Q J • ~ • •' 1 ' • 1 ":~. t _. ~ f` i .. ~ ..~ • ^ ..~.' ~~ r t• N-: - < _ ~ ~'r - p~~ ~~t/~~~ ENO //g$~s~jj~~.(~~orrf''~iv y~ z ~i ~sr~1rd601~•t~o . t 1~ ~ ~~ `e~ L J V S ~--~ S , r ~: ,~ ~I i ~I~ _~ O O U •~ O nL' W ~ a ._ o ~~ _/ r ~~ ^, ~.. z V Z ^~~ i` ww~ ._ a. t:•r .. ,~-~~_,a~ ~ ~ ~~ ,~. r ~ 7 t,~ ~ „"~ j ~'` ~}yam f ~ ~~-~ ~~.-7..3G~ ~~ • ~ L:1 t~ ~ ~1~ ;~ 1 ~ ~~~~ ~tk ccam~,, • ti ~ •~' r 5R •*3"y~ r~~ ~`~' ^ti* S~I`ii gyp.. t rY ~ ~ ,~ de N~`'~"y k ~~ ~~ 'rah -..t~~ •~_,. w ~ ~~ N~ •~~F'~ ~-- . x • ~~ l ~M~ ~.. ~,- ~ • • C ~ :w J3' ! 1i~ • .IA~r3y` ~•. ~~ ~ ~~. F V ~ ~~~~. ~~ ~_ ... ~,. ~' 7y ~~, r ~~ . ` '~~~ l L r•: . ~~ ' ~: .. .t +~~ C Y N ~ cE c6 ~ C ~ C U (n N d - U ~ ~ ~ ~ . C ~ = T~ cd ~ ~ N C C "= ~- C O U W ~U-6 'O Y_ W Y U ~ O.W `(n ~~LL O E~~ O O W-0~L RS O C ~ QO.T- U~ Qi.U ~1 U~ ~ N Q C ~ C ~a OF-mi°~cncnQ~iic~n~ ZO~O~(nV-»~X>-NQ C Y OJ ~ ~- ~m oa ~- o ' ~, m~ O a~ ~o E _ i . m~ ~_ ~ j l ~ ~ ? ~ O O ~ ~ °~ ~- a .ro ~,~ o ~ ~ ~.~ ~ ~'O ~ ~ U~ ro ~ ~ m ~ ~ ~.U ~~ Ctl C ~ ~Cn ~ ~ C U 1 - L ~ ~ ` C p L C Y E -. ~ 0 i`~ ~ W } ~2(n~C~CCLL~W~2W ~ ! ~: ~, J QCOU~WLLC72-~YJ~ t: . ~L ~ ~ 1 '~ t :~ ~ 'f~'~~ v .~ 1-i ~~ t f~ _ ¢ o, no om c~ ~~ N -O _~ ~VV L w ^~ O O ~~ ~~ ^. O ~ ^, ~ W ^~ ~z~ ~ '* NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION _ Meeting Date: 09/21/98 . ~ Regular Item #: 6 Estimated Timer Page Number. Department: County Manager. Presenter: Bob Mayo, N.E. Library Action Committee, A. O'Neal, D. Paynter , Contact: Allen O'Neal . SUBJECT:, . ~ Consideration of DesignlEngineering Cost Allocation for N.E. Branch Library and a Letter of Support for a Naming Opportunity . BRIEF SUMMARY: The Northeast Library Action Committee is suggesting a 50/50 split on the architects fees for the project - Chairman Caster, David Paynter and I met with the committee co-chairs-Jane Freeman and Bob Maya The attached. memo describes their reasoning behind the proposal. We also discussed the need for the County Commissioners to write a letter advising that a substantial donation in the X400,000 to $500,000 range serge as an opportunity for naming the library. The, current fund raising. has surpassed X400,000. RECOMMENDED MOTION AND REQUESTED ACTIONS: ~ .• FUNDING SOURCE __ . . ., .. „_. - .ATTACHMENTS: REVIEWED BY: LEGAL: N/A FINANCE: N/A BUDGET: N/A .HUMAN RESOURCES: N/A COUNTY MANAGER'S COMMENTS AND RECOMMENDATIONS: Recommend accepting the arrangement as proposed by the Northeast Library Action Committee and suppport a naming letter. ! • • _~ ~r .i 'r __ ' • ,. ~ COiV1MISSIONERS' ACTIONS/COMMENTS: ~~ APRt~VE~9 ~/' REJECT~C} {~ . ~ !?EMOVEp POSTPON~~! MEfiRD € SATE. ~ 17 ,~ in association wi nds of The Library 201 Chestnut Street - ' ~~ Wilmington, North Carolina 28401-3942 ,: (9,10) 347 -4389.. (910)` •34 Y -4357. Fax - ~ . August 20,1998 ` _'. ,. .'~ To: Ne~~~ Hanover County Commissioners .Subject: Design/Engineering Cost .411ocation for Northeast Branch Library . ~ - In approving the design contract for the former Hannaford building ,the Commissioners stipulated that the approximate $77,000 design costs should.be paid from the Northeast Library .-•,,, fundraising proceeds. • ~ ~. • 1 ~ The Friends of the .Library and the.I~Tortheast Library Committee(NELAC) cannot agree that `any of the. donated •fiinds.be used fo'r any purpose other than costs directly rzlated to~ the library. All of the fund=raising literature and our contacts with donors have emphasized that thz funds would be used for renovating and furnishing Qn~v the library space' iri this building and not` for acquiring the property or for other building uses. Due to the-above and.the following reasons; we recommend,that an agreed upon division .~f ih~ design costs be used to allocate these costs between the county and the Northeast Library Funds: l.The architectural contract covers the design and engineering work for the entire property -not just the library portion. 2. A significant part of the design & zngineering costs is to.determine the code & special construction requirements because of the multi-purpose use of this property. This multi-purpose use will also add to the renovation costs, including the library space. 3. The county's budget for this project included a portton of the library- cost that would be ~' ... . assumed by the c.ounty.~ 4. It w~11 be difficult to accurately separate the design costs between the overall building requirements, the library and the other space (office, meeting.rooms; storage; etc:):..: -LL -- ~~'e recommend that the design costs be allocated equally (~0-50°%) between the County and the Northeast Library Fund with a maximum of $40,000 to come from the donated funds. Progress payments t~~ould apply. The reason for the maximum is that the library scope is included in the original design. contract and thz other space requirements have not been finalized. ~~t~ We ho~~e that y~ou~•a~reeto~3t~his~p°r~oposed split ofthe costs so that the design work can proceed without further delay We~a~re~avalable at your comrenience to discuss this or answer any questio s. ~~~~~~~ ~~~t~i~ „Ma~~o ` - 3~At~ . _' ~, ' NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION . ,~ ~ Meeting Date: 09/21/98 Regular Item #:. 7 Estimated Time: Page Number. ' 'Department: County Manager Presenter: " Contact: Patricia Melvin ~ - ... SUBJECT: _ . ' Consideration of Funding Request for Community Development Corporation for a Business Incubator Program . BRIEF SUMMARY: . The Wilmington/New Hanover Community Development Corporation is requesting $1.50,000 to assist them in establishing a second incubator in Wilmington. Available options for funding the request include the following. 1) Contribute a portion or all of amount requested from contingency fund during FY 1998-99; 2) Contribute a portion or alf of amount requested from fund balance during FY 1998-99; 3) Contribute a portion from either contingency or fund balance this year and budget balance for future year(s); - 4) Make no contribution during FY 1998-99 and include amount requested in budget for FY 1999-2000; or . 5) Make no contribution during FY ~ 998-99 and include a portion of amount requested in budget for FY ' • 1999-2000 and the balance in FY 2000-2001. , RECOMMENDED MOTION AND REQUESTED ACTLONS: Review request and available options. FUNDING SOURCE: ATTACHMENTS: _ . REVIEWED BY: ~ . LEGAL: N/A FINANCE: N/A ,BUDGET: N/A HUMAN RESOURCES: N/A ' COUNTY MANAGER'S COMMENTS-AND RECOMMENDATIONS: Consider request... ' COMMISSIONERS' ACT ~ ~/ IONS/COMMENTS: ;. CdUN"~Y COMM~SSI - APPROVED [] REJECTEp ~ f4J .. ~ REMOVED CZ POSTPONED t~ ' HEARD ~~~ L~ . . pAT~ ~ ~ ~ g WILMINGTON/NEW HANOVER COMMUNITY OEVI=LOPMtrNT CORPORATION MEMORANDUM '' TO: I=RON: DATE: ' RE: NEW HANOVER COUNTY COMMISSIONERS ~•' ' ~ ~ • ~° ~ ' JRCKIE PEOPLI=S, J.D. AUGUST 10, 1998 ' ~ ~ ~1NANCIAL SUPPORT I=OR SMALL $USINESS INCUBATOR ~ . - °• ' Oh behalf of the CDC board of.direcfors, I hereby,.request $1.8D,DOO ,to - ~ • ~~ - =support the' ~developm'ent of uanother small business incubator in ~ ~ -~ Wilmington. _ t . ,, , . . _ ._ . .. ~r .,. ~ . _ . ,~~ The .City of Wilmington- awarded the CDC $180;000' on August 4, ": • ' ~`' '~ ' 1998.. •. - : - ~ ~ ~ ... .. _ ~ ~ - .. t ... _ . - ., 1 i . • Our current incubator, the Wilmington Susiness'Cerite~,~is located in The. Hitton industrial. Park at 811,..Corn~lius Harnett Drive, .,..The- CDC _ : , ~ was awarded a'three year federal grant, in the amouri[,,-of,$397,7~0, m ~_, ~: .., ~. ~~ 1992. The CDC raised an additional ~365,DD0. The new structure was completed in 1994. The incubator is financially self sufficient. .__ - ' ~ '~~_ • Approximately 34 businesses, and 80 permanent, full-time jobs have ~ _ been created since 1992. More than half of These positions were filled - - - - by low income persons, The incubator's contribution to the tax base has been significant. • The CDC has regiaesteci $200,000 from ttie~ State, and ~BDO,ODO from ~ ~ ~ r the federal agency that granted the first award in 1992. • The proposed life for the new incubator is theo- fox Nolsum .Bakery at 13th and Meares. It is within .walking distance of Two public housing, developmQnts: Hillcresf and Houston Moore. The asking price is ' - $875, ODO, • Renovation and repairs are expected to cost S3DD,D00 to $4nD,ODO. ~ ~ik/Q~'~$A C3 ~13'?;~1,~~ In~'2t~~ .. ~~~ 9 ~4 20 ~" Wili(Chotrrrionster {~ffir:E IIf .~~ ,y r, .~ Robert G. Greer ~~~Z~ .~~ ~~~~~'.~',~~' ~.~~~Z~ ~ Vice-Chotrman . ~ > i ~PfLT ~IITIIIfJEZ' ~I77.ZTIf~ ~~fHOA7N~QD Buu Blrzenleks ` ° Commissioner 32II ~1jE~frcuf ~t2EEf', ~li~7um 3II5 Wanda M. Coploy . ~ilrrringfaiz, ~urtll (fjurQliiiu 2B=?17J.-4D93 CountyAttomey Ted Davls, Jr: CommL~sloner `~P1;Eg~zrns (J1II) 341-714 Allen O'Neal County Manager Charles R. Howetl ~ux ~~1D) 341-41317 Commtssloner Lucie F. Harrell Clerk to the Board May 15, -1998 ' ' U.S. Department, of Health & Human Services Administration for Children & Families Division of Discretionary Grants ~ " .. 370 L'Enfant Promenade, S.W. - Mail Stop6C - 462. - Washington,. DC 20447 ~ ' . ~ ` '. ~ 1 Dear Review Committee` It has come to my attention that the VJilmmgton/New Hanover Communrt Devel (cDc) will undertake the task of developing a small business incubator. y' oPment Corporation . The New Hanover Coun ~ `' ty Board of Commissioners supports this effort because of the economic development potential it presents. The cDc has already demonstrated chat they have ille understanding, - "and the capability- of developing a successful incubator. We are optimistic about the jobs that will be i created for the low income community, and the business opportunities that will unfold. Ms. Ptroples will"present a financial request to the Commissioners in the net too ..distant future. 'I am `optimistic that the Commissioners will do what we can to support it. _ Sincerely, ~ .. William A. Caster. ' Chairman _8 _ , ~~~ .~-.Y.. 2 ~ . . .:, ~ ,' ±" 2~2 :;.: . ~ NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION Meeting Date: 09/21/98 Regular Item #:~ 8 Estimated Time: Page Number. Department: Governing Body Presenter: Lucie Harrell Contact: Lucie Harrell SUBJECT: -_ Committee Appointments BRIEF SUMMARY: Appointmehts are needed for the following Boards and Committees 1. Board of Examiners. of Electricians . 2. Board of Fire Commissioners " 3. Ciminal Justice Partnership Advisory Board 4. Library Advisory Board 5. New hanover Regional Medical Center Board of Trustees ' 6~. Nursing Home Community Advisory Committee 7. Planning Board " RECOMMENDED MOTION AND REQUESTED ACTIONS: Appoint members to the boards and committees FUNDING SOURCE: ' ATTACHMENTS: Committee Information Sheets andaApplications " ITEM DOES NOT REQUIRE REVIEW :. COUNTY MANAGER'S COMMENTS AND RECO MMENDATiONS• Make appointments. . COMMISSIONERS' ACTIONS/COMMENTS: .. _ ~oulvN co>v~Mlsst~» ' ~ APPROVED Cl , ~. ' REJECTED ~ REMOVED D . POSTPONED CI . HEARD t~' // 23 COMMITTEE APPOINTMENTS ~ : ~' y BOARD OF EXAMINERS OF ELECTRICIANS r ~__ ,. .. _ - _ _ ~. :. _ ~ .~= Tom Ba{dwin Charles L. Robbins James B. Steele ~ ' . _.. .. ,. 1, .,. „.,,:. _ ~ .. ,, .~ W ~ _ .. Attachments: Committee Information Sheets Application I~ c»vo~~ v cite ~~~~~~~~ ~~~ NEA A.ANOVER COIINTY BOARD OF EXAMINERS .OF ELECTRICIANS Number of Members: 5 consisting of: 1 Chief County Electrical Inspector 2 Independent Electrical Contractors 1 Nominated by Power Company 1 Electrical Contractor Nominated by the County Division of N.C. Association of Electrical Contractors Terms: two years - may be reappointed Regular Meetings: Compensation: statute or Cause Creating Board: New Hanover County Code, Chapter 5, Section 5-132 Brief on the Functions: The primary purpose of this Board is to issue certificates of competence to Journeyman Electricians and Apprenticeship cards to new electrician helpers. The Board establishes minimum Journeyman standards and issues certificates to those passing a written examination. Generally, recognition is given to Journeyman certificates issued by other jurisdictions. CURRENT MEMBERS Harry Dorsey 1815 Rock Hill Road Castle Hayne, NC 28429 675-9282(H) 675-9596(W) PRESENTLY TERM CATEGORY SERVING EXPIRES _ Electrical fourth 9-1-98 Contractor Russell B. Long, Sr. 245 White Avenue Wilmington, NC 28403 791-9114 (H) 392-3242 (W) C. F. Hall 424 Bayshore Drive Wilmington, NC 28405. • CP&L Co. P.O. Box 1110 Wilmington, NC 28402 (Appt. 9/4/90) (Reapptd. 8/92, 8/22/94, 8/96) Electrical third 9-2-gg Contractor (Appt. 12/16/91) (Reapptd. 8/22/94, 8/19/96) NC Assoc.. Nominee Power Co. Nominee Ralph Shaw Chief Electrical Inspector New Hanover County Inspections Dept. 8/96 2~ NFW NANOVF'R COUNTY ~'~~ '^f~~ . B DA RD OF COMMISS/ONERS ~' ~ ~qq~ 320 Chestnut Street, Room 305 SEA 1 y. Wilmington, NC 28401-4093 , . ~ , •,. ~ ~,-,;, Telephone (9 1 01 34 1-7 149 FAX (9101 341-4130 App/ication for Appointment, to Boards, Committees, and Commissions Appointed by the New Hanover County Board of Commissioners. Request for Appointment to: ~ (Z~ ~~ ~~ ~ t w Erl./ ~ ~,. ~ ~ C C . ~~- A NI Name: ~ Y~ A~ .t+~ Home ~ T~ How long have you been a Address: I I ~l ~ SS~~ ill ~~ , resident of New Hanover Countyl Mailing Address: ~ ~ . 3~- ~5 ~ City and State: _ ~~ ~ I M~..-~-tz,N Zip Code: _ Z $ o (~ Telephone: Home: _ ~7(o"Z_ cj -7 3 Business: -_ ~Co Z' ~ 5 ~ 'Sex: _ ~ ..Race: 11J 'Ape: , y 3. 'This information is11.requested for the so/e purpose of assuring that across-section o/ the community is appointed. ..Employed by: ~ P•1Ciwtrl ~c~NS-~,ucscu~, ,~~yLU1~1 ~.C "A person current/y amplo yed b y the agency or department 1or'which this app/ication is made, must resign his/her position with .New Henove~ County upon appointment, in accordance with Article V/, Seca 4 of the New Nenover County PersonneLPa/icy. ..: .. . Jobe Tit/e: '(Z(isi~ct.~- .... . Pro/essiona/Activities: VolunteeiActivities: Why do you w/'sh to serve on the Board, Committee, or Commission requested? _ YES • What do you feel are your qualifications for serving on the Board, Committee, or Commission requested? t~ ~ ~L-meal ANA G~n~~2fl 1 Q.~-stT2.l~~2 Sl+ve-ti `~ What areas o/concern wou/d you like to see the Board, Committee, or Commission address? ()N I Fo(~ -.~~'FI C~-T7 D t~ D~ ~ ~~C7n-lCf A tLf (bnsT'1 ~.t U 1 n! 4 T~17~ ~ t- c,--.-, _ . i Are you currently serving on another board or ,committee appointed by a municipality or a county? /f so,•p/ease list: No Date: _ Signature ` lP/ease use rev de for additions/ comments/ (OVER) IVEW NANOVER COUNTY BOARD OF COMM/SS/ONERS 320 Chestnut Street, Room 305 Wilmington, NC .28401-.4093 _', Telephone (9101 341-7149 . FAX (9 101 34 1-4 130 Request for Appointment to: t._ _~. _ Name: a y` ~ J__ oY S ~ ~ , Home ~ How long have you been a Address: ~~ Q ~~~_~~~ ~ resident of New Hanover County) ~p3 .- i'=s Mai/r'ng Address: ~ ~ ~ .~~ ~ K e City and State: ~. (~ r ~ Zp Code: .~ ~ ~ Te%phone: Home: ~ f ~ - ~~~ `7r/ / Business: _ j ~ ~ ~ -Sex: -Race: ~ -Age: LO 'This rnfa matron is requested for the sole purpose o/assuring Thal across-section of the community is appointed. _.Employed6y:~~~~~(~..,5 ~l~C ~O "A person currents emp/o yed by the agency or department for whrch lhrs app/rcetron rs made, must resrgn hfs/herposition with , New Henove~ Coun/ty'~upon appointment, in accordance with. Artic/e V/, Sec, 4 of th'e New Nenover County Personnel Po/icy. .;,, , ..: Job Tit/e: C~/f~ 1/~P'jJ' Professional Activities: Vo/unteerActivities: (~ /} ~~7 ta,r.~ Wh y do you wish to serve on the Board, Comm~'ttee, or Commission requested) ~ .Q~ What do you fee/ are your qualifications for serving on the Board, Committee, or Commission requested? /'~ -_ What arenas of concern would you like to see the Berard, Committee, or Commission address? ,$ lam- l,, c --~~ ~o~ PJ.S'Sr ~u a, ~ 1~~ t~f'" Are you currently serving on another board or committee appointed by a municipality or a county? /f so, please list: ~~,: Date: ~-~ ~~. ~ ~ ~ _ .. ,.~- ~~ ~'_ (Please use rev e for edditione/ comments) • ~ J S'gnatUre - SfP 0 ~ ~~9~ (OVER) App/ication for Appointment to Boards, Committees, .and Commissions Appointed by the New Hanover County Board of Commissioners. _ ~, 1- _ ~ !" f r ... , _ ... _ JI r NEW HANOVFR COUNTY BOARD OF COMM/SS/ONFRS 320 Chestnut Street, Room 305 Wilmington, lVC 28401-4093 ~ .. ~ - - Te/ephone (9.101 34 1-7 149 FAX (9.101 341,-4130 - App/ication for Appointment to Boards, Committees, and Commissions -. `• . Appointed by the New Hanover County Board of Commissioners. .- ~ , ~ Re uest !or A `- ~ °~ q ppointment to: -. - .- - - _ - - f •Blectricians Name: ,lames B. Steele '>~ ~_ . ,` '.,;- • - ..- ...v. - „ , Home - - - How /onp have you been a Address: 616 Sic3bur Rd resident of New Hanover County? 14 years Mailing Address: same a s above ~ '> City and State: ~Ca'stle'• Hayne;• NC Zip Code: 28429 Te%phone: Koine: 910/675-8916 Business: 910/675-3012 'Sex: Ma 1 e ~ 'Race: White 'Ape: 3 7 'This in/ormetion is requested far the sole purpose of assuring that across-section o/ the community is appointed. "Emp/oyed by: Steele & Manning Electrical Contractors "A person currently amp/oyed by the agency or department for which this app/ication is made, must resign his/her position with ,- New HenoverCounty upon eppaintmen[, in accordance with Artic% V/, Sec. 4 of the New Hanover County Personnel Po/icy.- _ _ ... . - Job Tit/e: artner in Ownershi Professiona/Activities: uildin Codes Committee, Member NCAEC, HBO of Wilmington Vo/unteerActivit/es: ppR Committee,- Ducks Unlimited, Carolina-Virginia Water Fowl Why do you wish to serve on the Board, Committee, or Commission requested? offer ex erience in assisting in selection of electricians and entices. What do you fee/ are your qualifications for serving on the Board, Committee, or Commission requested? 0 years in electrical field What areas of concern wou/d you like to see the Board, Committee, or Commission address? Date: ~ (Please use Are you current/y serving on another board or-committee appointed by a municipality or a county? /f so, p/ease />'st: COMMITTEE APPOINTMENT BOARD OF FIRE COMMISSIONERS ~~ . ,~ 1 VACANCY - At-Large Community Representatives - AT-LARGE COMMUNITY REPRESENTATIVES APPLICANTS ~i Michael S. George Horace C. Johnston, III Darryl T. "Chuck" Langley Michael H. Moran Thomas R. Mull _.: Ronald K. North... ,. . . _ ., . _ - _ -~ - ~ Attachments ~2. Committee Information Sheets Applications ~; BOARD OF FIRE COMMISSIONERS Number of Members: 9 4 At-Lazge Community Representatives (must pay New- Hanover County Fire Service - .. ~ District Tax and have no affiliation with any local volunteer fire service organization, nor have been an affiliated member of such organization for the past three years) ` 4 At=Large Volunteer Fire Department Representatives (must pay New Hanover County . Fire Service District Tax and be a candidate submitted by a Volunteer Fire Department) 1 County Commissioner . .Term of Office: three years with. no one serving more than two full terms: Regular Meetings: Fourth Wednesday of the month at 7:00 p.m. in the Emergency Operations Center - of the Law .Enforcement Building. ` Statute or cause creating Commission: Resolution adopted by County Commissioners on January 6, 1986, adopting the Fire Service District Task Force Report and Recommendations. TERM PRESENTLY TERM CURRENT..MEMBERS SERVING EXPIRES .: :..:. At-Large Community Representatives ` Brenda "Ben". Brow Unexpired 7/1/99 . 426 Tanbridge Road Wilmina on, NC 28405 (Appt. 11/3/97) 799-$078 (H) 452-7988(W). ~ • Mike Denni n (Resigned 6/15/98) Unexpired 711/98 • ^ ..404 Si a Drive . . - W' mgton, NC 28409 (Appt. 11/03/97) t 13-1180(H) 791-2222(V,~. Wayne L. Hartsell, Sr. _ First 7/1/99 303 Teruressee.Avenue Carolina Beach, NC 28480 • (Appt. 5/16/94 to unexpired term) 458-4146 (H) 655-3856 (W) (Appt. 8/19/96 to 3-year term) .. . ~ James W. Sawyer ~ Second 7/12001 222 Inland Greens Circle '• Wilmington, NC 28405 (Appt. 11/20/95) 452-9724(H)> ,. - ~ 33 BOARD OF FIRE COMMISSIONERS (CONT'INUED) ' f\ TERM .. .. PRESENTLY 'T'ERM ;CURRENT MEMBERS ~ .: •. SERVING EXPIRES AT LARGE. VOLUNTEER FIRE DEPARTMENT REPRESENTATIVES: ..Dominic A.; Bianco, Chairman ~ ~ =Second ~ . • 7/1/99 144 Michael .Drive . - '. ~_ a Castle Hayne, NC 28429 (Ratified 6/21/93) 675-0524(H) 341-784-6(W) ~ Reappt: 8%19/96 ~ • Wilbur Davis ; ~ . ~... : _.. ~ ^~' ~ , : ' • ~'Firsf 7/1/99. - 615 Piner Road Wilmington, NC 28409 ; . .. ~. -, . ~~ , (APPt. 8/19/96) ~ : ~~ . • 791-2231 (H) 675-5430 (t~ - Michial W. Rhodes... ~ Second' ~ -7/1/2001 ~ . `. 2000 Chair Road , ~ . - - .. - ; . ~ ~ _ _ _ Castle Hayne, NC 28429 (Ratified 11/20/95) 675-3198(H) 799-1232(V~ (Reappointed 6/15/98) Jonathan A. Wrenn First ~' 7/1/2001 ~ " 203 Hepwoth Way . . . ..:.:..:..Wilmington, NC`. 28412.. _ _ _ (APpt.' 11/03/97, Rea pt. 6/15198) 793-0674 (H) 793-0201 ' i ~. County Commissioner ~ `~ `~ ~ ~- •~ Charles R. Howell ~ :• ~-~ 6/98 file: /fire .. , ' '. - - - _ .T. ,. _ ;,.. 34 r~ • IVt~'W HANCJV~R ~Q~/11rTY #~'OAR1a ~~' ~O~11V1/~SIDIV~R~ 320 Chestnut Street, Room 305 ~.~~,rn,~, Wiiml~lgton, 11IC -2~'~(~ ~-~40~3 ~~ ` ~~ f ~ ~ ~' -' ~~~ r~repnan~ rs ~o~ ~~ ~-»4g ~L1 2 7 199) . FA.x rs ~ o~ ~ ~-~ X30 ~4pplicafipn far Board. of fire Commissioners h~~~- +-~HOV~ co. E'~. ~_ ~C,~14',1?,;~~G~`, At-large ~Qmmur~if-y Represen~a~iv~ Name:~/~i/~iFL S-~ ~q~~. Nome How lor~p have you been s Address:l~~~yP.~J6~,y~ ~;~ { ~ .l,'.v r8sidenf of New Nat76vPr Count f~? M ~.S ,.~ Mailing Address: /~9• f ,84,c; ./ - ~.c~ . City and Stale: G~i~i ~ ~1C ~l~ Cvde: ~8~i,°o.S^ 9oz Telephone: Home; - ~ ~~ - c~ 77/ Business: ~ dz ' y/9~/ _ ti 'Sex: ~ "Race: ~~~ Aga: ,L? 'This InlarrYletion is ratfu8sted for the sv/e purpose of ossufing rhat g Crossaection of aSe commur)ity is epp01r1ted. • 'A pQtson Curren !yf 6mpfoyed by 1h~ eg~ncyor dap~rtmont for ~yhich fhls application l5 ~7~sde, must rasr,~n hls/harp iUpn tvrfn fJowNanovor Gounfy upon appDlr7tmont, in aDCVrdsnce with Article/Y/, JSec. 4 0!/th~e /Netiv N9n`ov~r Gounry Parson ~f ~Iicy. Job 71t1e;,~ ur'r :.~1~-~d~n-~ ./"al<'e~<a/~~ r~~~ !q-. •~~ 5,_L~---~ _ PrOfessronal Acfiviiies: ~C f~ -- .>.-c ~~'1 -- ~S~L~'7`" -- 4rw/td~~_.~fl~'c~+~/S ~ ~'~r7'; ;,~/ nlK.,a Nr4.vevG,e vice., rfGri~c+~ - VoluryteerJicfvifies: ~~ ~, 6JF,<, ,~;C~~-. fJ a Why do you-wish to serve an tl~e Ba&>'d of Fire CommissionQrs~ / ~ -_~ -- ll // ` /j _ ~- ~s t 'WJiat' da r~u feel a/e your 9ualiflc~t/ins ~4r serving drt the Board of Fire Cammissioner~7 ~~~~~ - ~ ~ :,_ . . What aromas of concern uvDUld you /ike io see tfie f}osrd of Fire Commr"sslDners ~tldress? _ n ` ,4~5(~~ Q~11 X11 ~ .C'~l - .~Lf ~r~l.Jti~+'~ Are y01! Ctrrrent~y servinD Or) another b0&fd Or t;dmmtttE@ app Dlnted by S I7)Ur7iCipality 4r a COUl7fy? //sD, ple~S@ !I'sf: . ~D r .- ?BrBpY ~fSr that / pay the /Year }/~~over C4unfyl~rre $er~rice District 7'ax and that /h~vt~ na et5'il:~~on with ~,~ y /deaf ~luntesr fire sr?nrTr=e pfgani38trQn~ nc5r have been an afi`I/iafed mombc}r ~{surh or9~nlz~fion fflr ihv psst three years: 3~/ l ~~ ~ Signature ~ -~ 'vas' usr'frvbsp s/o's toraddrrionaJ cor~mantsJ SEP='3-98 THU 13;34 • ` P. 02 NFW NANOVER COUNTY :BOARD OF COMM/SSIONERS 320 Chestnut Street, Room 305 Wilmington, NC 2840.1-4093 . Telephone (9101 34.1-7149 FAX 1910) 341-4130 Application for Board of Fire Commissioners At-Large Community Representative Neme:_ f7D f'ulCe C, cJV ~tn'~~i s~ ~ ~'~,~ /e) Home Haw long have you been a Address: _3lD y ~~~1 `~ ~oc, f~" .resident of New Hanover County? ~ ~ ~t5 Mailing Address:__I_ '31U~f ~lltt-S ~'~- ` G'ty and .State: h/ , I~ M ,`n p 7`~ Yl ~ ~L I~p Code: 02• ~~/US Telephone:•• Home: _'7 ~O - .3 ~ c~ `~/ ~' ~ Business: g/~ ' 3 ~J/` ~ ~i'U O • `Sex: /~l d,~ ~ "Race: l../ ~ ` _ g 3 , f' P *A e. 'This lnformetlan /s retluested far the sale purpose of assurlnpM~h~t across-section of the cornmuniry is apporntod. , "fmployedb'y: lUC't~ ~o,~dy~[' 4,~ ~nrn~ ~' 1 ~i`CO~~ Cen,~~°l'- ' •A parson current/y employed by the epency o deparimont for which this eppGcation is made, mus[ res%gn hrs/horposition with Naw Hanover County upon appointment, in accardonea wilh Article Vl, Sec. 4 of the New Hsnaver County Personnel po/icy. Job Tit%e; ` PG\ C o. t~l e~ ~ ~ ~ rn ~ ~m i ~ :.: ProfessionafActivities: Pg(o,1~1ea)I~G Co,p~o,;t~ c of ~(R,(nC-~,~ 3 'f C1PE'~~C. 5ma~l C n lea n I`na /"~r~~ ~ ~~5 ` VolunfeerActivities: ~,~~ ry~~ ~~~r • ~ Why do you wish to serve on .the Board of Fiie Commissioners? .l Wj`~~ f G ~2S A~ ~~ ~j~ g r~ ~~ ~'re Co„r,n,,`ss1~-ner ~~ s u~~. ~ ~;/~ ecv~`~~ w,`{~ r 11 J ~~ O~ !~'I~.y Lvn/7 uP~ 7o irh fo1K ,nd mUJ'~ l`.., rl\Q. f '1~' r ~r VYliat do you fee/ are your qualifications for serving on the Board of Fire Commissioners? t"offT~ . er/ ~~'r ~'rqh(~~~ • ll~ac'~y I~`-~~'vnG C~~u n~~ ~t°~,`~Cn 1~ ~ , • What areas of concern would you like to see the Board of Fire Commissioners address? _ ~ I,`m rin ~'~j ~ ~° t ~~ r t ~a~ ~e o ~ u ~rr ~e 1 rn ~" Gl md,\ ~ v. ud ,n ~ t can / ze a.• c~~~~ ~,rdc Cray h fe~ru~ S~CV~c.C .`re e(~Ur Mrs,=vjZS Are' you ~urrently serving on another board or commit~e appointed by a unicipaGty yr a county? /f so, p/ease list:. 'Y. /hereb y crjrtify that /pay fhe New Hanover CaLntyFire Sere/ce D/strict Tsz end that /have n0 afflieLon with any/ace/ volunteer fire servicc~~ organization, nor have been an affih6ted member of such organization fns the past three years, Date: _ ~' `-~' L~ ~ - . ,r, ~ C ~eese use reverse s/de ror edd'Gond cammeq ti/, .. ~ . (~:; ! t S%9nature ~ . . SEP 0 9 -1998 , . 37 . .'. r ~c . - ~ -.. • -...... .ail? Oltl dpdct~s for tae . ~ `'~~.- M4pah..irr.can~w-~,~,na,vs . y20 Chestnut Slr'eet, R'oO~ fps ~ilmi»g#on, .NC 284D~-4093 Tel~~l.~rnre (910) 341-71d9 - .. .. FAX (91AJ 3d1-dl3Q ' . 4 • ~ A~SplJ~'on fvt A~Po&ttme~rt In l3oard~, Cottrm~tXees, and Cnmrniss~:'vns _ f ~°~~b3' ~ ~Ytw Km rm~et' County ~oQtAi of Corn»~ssdoner~. Requext,~r..4p~oinb~ent try: ~~ '('. b 1'n S l ~iJ .: , , .._ 4 ., : ,.. Name: ~l-_~~ ~, i ~ C ~ t/ ~l s 'r ~ . _ - How long !save you been a resident of~/ewXanox4r Co~cn(yP, f . - . - HaASe}iddrBSS:. ~ Z.03 ;rY1 ~ t ~ ... c~ ' ~~P ' --. o Mailir~g~4dd,~.ss: ,~__O ~ ~ ~_ 1 b'a .~j ~ _ - _ ~ .. _ I • City arsd SYafe: ~ t ~ .. '_ Telgplsans: ,Na7-se: ~ ~ ~ ", ~ ~ ~ ~$t~ -~~~_ . . - .. ,, Bus#nes~. tSe~ 'Wl *Raca ~V '1'hlr.infvtmafionis requested the sole : ~ :: ., :Age. -. ` ~' .~~- `'. ~ ~. .~" picrpose afar: ~rin8 that a cross-ssiiion aft/i~ community i~r appainte~ _ j~/ ~Y" .. ., r ._, r ¢A parson currently entploy+ad b3'the ug®ncy ar depttri~tteni, for whtch 1hi~ appl#cafion,is mane, must sesi n l:islfser ATew Hanover County upon appoint»sen~ fn accordance t vt#s AreYcle Yl, Esc, 4 of the XVew Hanover Couniy~'erso»nel flolicy, v}th .lob TYtle; -. r ~ , _ 3C . .. _ _ Prrsfessidnal~ctivitiss: ~oA,~'d D-~ ~ 7' Ydlunfesr.~ctlvlflee: C.~ Y ~-~V.'L.ffQ.Y' ~ .. lT,_~ ~ Y¢..~Q Why do you wi,~h to ~grvs an tlse Board, ~amrnittee, ar Ccuttnfiaaion rsqu~sfad~' ` ` y~ ~ ~ .. - S- SCa~ P~ _ ~~ 4 ,Y. / d~ ~ t What do t1 1 are '. ~. - t. 3~ ~ your qualificaiiana far sarvi th s Board; Cornmitta~r, or Commisrion sgr~u®sledP What artear of coneArn would yea Gke to ses the Board C~nsmittes, or..Commissfor, acirlress? ~ ~---- ' ~ ~ , 2^~ ~ flte ymt curre~nt~y sewing on anofhgr board or cammittes appointed by a muntcipatity or a count? Ifso, please jf~. ~~ e~ ' < U . C_ .~r@ y+att cur~nt~y serving on another board or corxrnitteg appointed by a munlcfpalify ar a cou~s~? ~}'sq pleura llri: ++~~~~~ 1,t~v~/www.coo~-~saooc~xnc,a~/cdsp~ DOES': ~ ~"" Pl~ara provide three local parional nsfe~ncev: . Name phaaze Number 3. ~~VZ~~/l ~~,fy'C ~411~~- ? ~ ~ [rte ~ ~N •. • 39 r r~-r NEW HANt~ V,ER COUN7"Y BOARD C3F Cp1L1N11S510/Vi'RS ~jL~r(j~~~`~" 320 Chestnut Srreet, Roam 30b Wilminytt7n, NC 28401-4093 ~~ ~ 1 1991 Telephone f9 t 0~ 341-7149 - - - FAX 19101 s41-4t3o ~ NON HANOVER CO. 8D. OF CONi411SSI0NfRS " Application for Board of Fire Commissioners . _ At-Large Community Representative " ,, . , Name:_j/~~C~~L f7`. ~v~OlP~4~ . ' Home rr~ How land have you been a Address: ~0 5 SG'.~jVt G ~t (2L~L~ ~/L ry ~,~/~;~~ resiUent of /Yew Hanover Count ~ y- 3~rox~ Mat7inD Address: _ ~ ~(E- City and State: _ GtiJ,1... rte t ,U 6 m.U rC./ , C ~ Zip Code: 2 8yfl . _ Telephone:_ Home: j/D - G ~(o~-~ 3 $'y7 _ , Business: ~ 9 / U - 6 ~'~ = CJDO t// iSex: _ r~7~~ •Rece: -~/('tl~ ."Ape:. j/~. _. - . - .. •7ha infornwfion is r~.t~.a..Ied farnMe :„/• p~~as of ewun},g that a croea-section of the communtly b' appo/nted. "Emp/Dyed by- 19~77¢G C:iQ~aZ tirJ/9 t5't1'` tgi2 -'st pwson cunentty arnp/o yad b y the epeney ordepertrnont fas which lhls applJcet/on Js made, must res/pn h/s/her posJtlon with New Renawr County upon app~ointmsnt, in ecrnrdence with Aitir/v V ~ Sec f oY fire NewHanovar County Person»v/PoUey. /ob 77t1e: _ -sue R y! ~F /17A-rL f}6~i f //{~20 ~P tF-si/~}- 6 ~rZ. Professrana! Activities: ~ .i/6 .~ ~ viC~ . •~s -~~ ~' yalunteerActrvities: _ ~/~E'E ~2 ~S•Cl~C-,iar~~1 ~°...f~~~ry J. Why do you ritish io serve on the Board of Fire Commissioners? ~~ /k}/ ~}tp~ Epf"/E,(,~4C- ~' g,~- r ~- ~~ ~'~ COt+/77e /BUTG 7D T~ 77f~ a~ ~f.v ~ .5~.12G4C~S - Wnat da you fool oro your quallications lar serving on the Board of Fire Cammissioners~ D v~re ~ ~ y What areas of concern wou/d you like iv see the Board of Fire Commissioners address? (~.E'E~~,t'. .S'E,e ui ~ ~'s Tt~ a.•,~e p iYl~.~r c 5;9.,c~T y Aro yOU cu-iant/y servln~ on anothor board or cammlltee eppoirftcd by e munizipalrty or a raunty? if so, p/ease 1/Sty ~Q /hernby~y f},Bt /a+yth• /Vowfrcn vDllrnl6B! fire 1 q aver County Ara Sefvrco D/1tr/r=f Tcx and that fhsva no ar`l?UatYOn w/r1f anylaca/ 8/V/CB Cyr' animtion, oar have boen an eN!/Isted msmbvr of soh or9c8nlss6"vrt foi !ha pc,sf th~BO yca~a, Dare: D ~ f~~ /rX.ais .a. ~rvers, rde lv ~gn2 LG ~do9(iona/ cvmmwntaJ 40 -- -- - - --- .. ..... _......_.._ ~~.........~.~.~,., r.n~ h~~~~~ ~ ~ .~.~~ y . %~~,e~z ~ ,, p~~ ~ ~~ ~ ~ D7~ ~,~~~ y~v ~- ~~ y sus ~ ~~~ --c>aoy -1~~-tJ~ ~ S`cY~7i~1~ 3~3.~~-7~7. .. - ~ .. • 41 NEW HANOVER COUNTY BDARD OF COMM/SS/ONERS 320 Chestnut Street,, Room 305 Wilmington, NC 28401-4093 Te/ephone (910J 341-7149 FAX (910J 341-4130 App/ication for Board of Fire Commissioners At-Large Community Representative Name: JUl 1 0 I,, . r~• ~ ~:... v: Home y~ /~ How long-have you been a Address: ~ 00 /~e S/ ~~/~ ~-~c!/I resident of New Hanover County? /~j ~~~5 Mailing Address: ~7 City and State: ~ ~ -Zip Code: ~ g/~O S Te/ephone: Home: 2°~/- ~ ~3 S^ Business: H S J _ o2-g~~f 'Sex: f~ "Race: /' ~ "Age: ~ j f . 'This information is requested for the so% purpose of assuring that across-section of the community is appointed. . „'Employed by: /~ /~ tl ~ - "A person Curren tly emplo j~ed 6 y the agency or department for which thu app/icafion is made, must resign his/her position with New Hanover County upon appointment, in accordance with Artic/e V/, Sec. 4 of the New Hanover County Personne/Policy. ... :. .. - - ., Job Tit/e: _Sc~a Jo J~ ~/~er/~2.~ S~ ~/ J-~ /t'r .~~~ io y~ . Professional Activities: y,.~,,~~ ~ ~~~7' ~;,~,~ r - - Volun tear A ctiviiies: Why do you wish to serve on the Board "of Fire Commissioners? ~ 1 ~L h t-f ii l v ~+.~ ~~/ lirn row ir_~ , What do you feel are/your qualifications for serving on the Board of Fire Commissioners? ~~.s ~1Cj~_ S /~h~ ~ /C'~hnn~~C',~~_ ~.~ ii,~-S C/7`Y c /C ~ l'. Q %6 ~Ltis C,~ ,L What areas of concern would you /ike to see the Board of Fire Commissioners address? _~~~ ~ ~,n~, ,, r _v / ~ Z=fn /.!'1 r' ( d~i~Ail~i ~ _ /. to n e ~/ -r; ~ _ .., _ . _ ~~ ,. Are you currently serving on another board or committee appointed b y a municipa/ity or a county? /f so, please /ist: /hereby certify That /pay the New Hanover County Fire Service Disbict Tax and that /have no a~/iation with any/oca/ volunteer {rre service organization, nor have been an af~/iaied member of such organization for the past hree years. Date: ~ Signature ,~-,~ (fYease use re arse side far additional comments) Thomas Mull 1) Bill or Sandra Dugan - 910!452=1091 - 10/350-6757 2) J.C. or Elsie Bndgeman 9 3) Dale or Dorothy Blade - 910/350-1990 43 NFW HANOV.ER- COUNTY BOARD OF COMMISS/ONFRS 320 Chestnut Street, Room 305 ~~~~Q~~ j ~ -~ Wilmington, NC 28401-4093 Te/ephone (910) 341-7149 ~ 2 3 1991 . FAX (910) 3.41-4130 __ _ NLW HANOYER CO. Application for Board of Fire Commissioners ~ 8D. OF COMM1SSlON~RS At-Large Community Representative Name: ~~0 ti ~ ~ % Y O ~ Home How /ong have you been a Address: yD ~j (/~~ ~,t,~~ ~~~. resident of New Hanover Count ~ `` y. /~ /1''Dl . Mailing Address: ~~J. ~~,a /,f„~~~ ~~ , t/'P City and State: ~,t~ ~ ~ ,, ? p ~' ~,~5 ~~ /~f~ Zip Code: ~d!/D~S Telephone: Home: ~~1 /0~ jo ~6 30?3 6 Business: 'v~.~ 'Sex: 11'1 "Race: ft> ",qge: ~ ~ . 'This information is requested for the so% purpose ofnensuring fhat across-section of the community is appointed. • "Employed bY: P I-'r / P ~ ~ i'7 ("o "A person current/y amp/o yed 6 y the agency ar department for wh,ch Ihrs app/rcation ,s made, must resign his/her position with .. New Hanover. County upon. appointment, in accordance with Artic% V/, Sec. 4 of the New Hanover County Personnel fb/icy:.: ; _. ... ,- .. Job Tit/e: e t-, ~ e ~ J ~-- ~ ~ ~..c~ ~ r/ ~ J v ~ ~. . Professional Activities:.~i~-~r~, ~/-3e~/~ ~~ ,~,~,, .e,,-,,,~~, ~y f ~ ~1L/ !0% r P,~ j ~ / ~ t VolunteerActiviiies: (~~ ~ {-~.1~ Y- /~r.rr c..~ ~ ~0 G~ ~S -- ~e r- ~e~~,~ s C ~ e l + 1 i~e ~ ~ ~~rr~ ~ ~1 I ~ Llo / Why do you wish io serve on t~hJ e Board of Fire Commissioners? ~.~ ~, ~,,., e,, ; ~ ~ r~-f~-r-z, ~ ~c r . n -Piz-/ Z_ P,v ~ ~ f-, r' ~r ~ ~ i-e ~ c li/ , ~~°, .-~ G P / ~t , .t ~ ~- ~ lr ~ ,, :..~ ~ - ~ 0 ti .i 77^ >a- , -v 7~ What do you feel are~,Your qualificatior}s for swing o~ the Board of Fire Commissioners. G a hs .f /. ~~, $ ~ •-,tom,.,- iS3,v.ve~3 Iv Pr'c/r~ ubi,'--= ~_ ~ - /C? yi`5 li-io~x~./c ~,- Mho: ~, 0 P ~~ /•,`c .5~~'.. r ,_~~_~ O/r+,~ rv~ S~ ~tI r ~~,~~ ~.J r l r r t 4, ,J 6ut~ p T~ ~ ~ What a~r/eas of concern w/ou/d you like to see the Board-o~f Fire Commissioners address? ~r roue ,~ i.,J ~~or~~,~r,¢r,~,,J (./ r C h ,~ /' e ts-s C `~ /~o ~ d /.r~-T i o -c~ Cj >r-~7 ,..t, ' `7 C e ,tl i , .~, ,,c F-/ / . /CJe./nn.J Q~-fnr't~ ~+~J7;,~~,N ,¢ /`t~.e~, ~~~~`ln-~o,~T p7 ~:/~ Jr 7`Y~ . v , ,L t r l n ~it T-r P / .S J ~ , Are you currently serving on another board or committee appointed by a municipality or a county? /f so, please list: ~C / hereb y certify that /pay the New Hanover County Fire Service District Tax and i at /have no af{/iation with anyloca/ volunteer fir~~~Prvica organization, nor have been an af{/rated member of su ~ rganization for the past three ears. \ /// Bate: " "I ~2" ~ /jam 7 Signature !A'easa use reverse side for eddilional cammenLsJ O !e / !,~ BEFERENGE S Please provide three local personal references: Name Phone Number 1 J ~ ,~ o~ ..So ,a .~ r ~ YoZ - ~~y 5 G 21 / e ~ ~ ~ !~ ~,+~,v . .2 s 6 ~ 002 / • 45 COMMITTEE APPOINTMENTS - - . -~~~ .. CRIMINAL JU-STILE PARTNERSHIP ADVISORY BOARD 1 Vacancies: The Advisory Board must consist of ten members; however, the .Commissioners may appoint as many as they desire. ELIGIBLE FOR APPLICANTS: REAPPOINTMENT CATEGORY Marcus Teer Benson At-Large ....Joanne Marr °. _ : X -_ ~ Communit Service Coodinator. __ Y.. (Moved from At-Large Category) . - Laura B. Overstreet At-Large Jeanie Renegar At-Large Joseph D. Thornton, Jr. Business Community/At-Large Attachments: Committee Information Sheets Applications 46 i i CRIIVIIlVAL JUSTICE PARTNERSHIP ADVISORY BOARD Members include representatives from the following categories: Court System, Law Enforcement, Health Department, Mental Health, Criminal Defense Attorney, Public Defender, Probation Officer, Community Service Coordinator, Business Community, Crime Victim, Recovering Drug Addict, Community Based Corrections Program, Victim Services Program, Employment and Training Professional (Minimum number of board members is ten) Terms: Initially staggered terms; thereafter, 3-year terms Regular IVleetings: Meetings scheduled as necessary Statute.or.Cause Creating Task Force: NC General Assembly .Purpose: The purpose of .the advisory board is to develop community-based solutions to the problems of rehabilitation and punishment for criminal offenders. The goals will be to reduce recidivism, to reduce the number of probation revocations, to reduce alcohol and drug dependency .among offenders and reduce the cost of incarceration now being paid by counties and the State. CURRENT MEMBERS - . .. . , Business Community Robert M. Deacy 3300 Bougainvillea Way Wilmington, NC 28409 452-4131(H) 457-2699 Community Based Corrections Program Dolores F. Moore Community Service Work Program 414 Chestnut Street, Room 302 Wilmington, NC 28401 393-9668(H) 251-5787('W) Community Services Coordinator Donna P. Williams 6905 Cedar Bluff Wilmington, NC 28409 395-4387(H) 251-5787(W) TERM PRESENTLY -TERM ..- ' ..SERVING EXPIRES Second 9130/98 (Appt. 9/94 to 1-year term) (Reappt. 9/18/95) Second 9/30/98 (Appt. 9/94 to 1-year term) (Reappt. 9/18/95) Second (Appt. 9/94, Reappt. 9/16/96) 9/30/99 47 CRIMINAL JUSTICE PARTNERSHIP ADVISORY BOARD (CONTINUED) Tri n • a Smrthe Second 9/30/99 Community Penalties Program, Inc. 208-A Princess Street ' ,Wilmington,. NC .28401 .. (Appt. 9/94, Reappt.'9/16/96) 763-5707(V~ . Joanne Man %~ TASC/Day Sentencing Center 801 Princess Street Wilmington,. NC 28401 762-5333 (VV) Probation Officer Terry Cosby Gootee. 430 Honeycutt Drive. Wilmington, NC 28412 . 799-1661(H) 251-5757(W) ••~~ ~ First (Apps. 9/18/95) 9/30/98 Second , , 9%30/2000 - (Appt. 9/94; Reappt. 9/16/97) Victims Services Pro ram .- Phyllis Spivey First .9/30/99 421 Wayne Drive .. .... _ Wilmington; NC ..28403 .. ,. . 675-9259 343-4129 (APPt. 11%18/96)- (H) 762-2468 (W) Members-at-lar e Liz Marie Marciniak Second ~ 9/30/2000 P.O. Box 4141 ~ •. ~ - Wilmington, NC 28406 (Appt. 9/94) ' 259-95.91(H) 962-3049(W) ~ ~ . = ' -~ ' Kimberly Ro rts First ~ 9/30/98 908 S. F' Street r ~~ Car 'na Beach, NC 28428 ~ .1 °1 ~ A t. 9/ ' 8-4981(H) 458-2992(W) i (PP 18/95) Ted Seawell Second 9/30/2000: P.O. Box 1537 Wilmington, NC 28402 (Appt. 9/94) ~ • 395-0511(H) 452-1122(W) Steve Woodard Second 9/30/99 P.O. Box 312 Kure Beach, NC 28449 (Appt. 9/94, Reappt. 9/16/96) 458-~28(H) 452-4253(VV) CRIlVLTNAL JUSTICE PARTNERSHIP ADVISORY BOARD (CONTINUED). A n R r n iv t cs. County Commissioner: Commissioner Ted Davis, Jr. County. Manager's Office: Andy Atkinson Judge of Superior Court: Judge Ernest B. Fullwood Judge of District Court: Judge John Smith District Attorney: John Carri.ker Wilmington City Police: Lt. J. W. Carey Sheriff Department: Captain Steve Smith Mental Health: Susan Hanson . Health Department: Betty Creech Substance Abuse Center: Virginia Gorman \Crime 8/98 49 NFW HANOVER COUNTY . -. - . BOARD OF COMM/SS%ONERS 320 Chestnut Street, Room 305 Wilmington, NC 28401-4093 -~ Telephone (9101 341-7149 - ' FAX (9 101 34 1-4 130 .' App/ication for Appointment io Boards,Committees, and Commissions Appointed by the New Hanover County Board of Commissioners. Request for Appointment to: Criminal Justice Partnership Advisory Board Name: Marcus Teer Benson ~' ' ' Home How long have you been a Address: 7308 Masonboro Sound Rd. resident of New Hanover County?_ 30 years Mailing Address: P - O . Box 15 6 91 City and State: Wilmington, N.C. Zip Code:. 28408 Telephone: Home: _ (910) 313-0975 Business: (910) 341-4226 'Sex: Male "Race: White "Age: 40 'This information is requested for the so% purpose of assuring that across-section of the community is appointed. iv c Pr~'T- a'77~'~T-f'-Y' ~'-n ll r~ f- a r ~ t r~ L 1 l:.Z,~ "A person current/y emplo yed by the agency or department for which thu application ~s made, must resign his/her posiiion with New Hanover County upon appointment, in accordance with Artic% Vl, Sec. 4 of the New Hanover County Personnel P~/icy. Job Tit/e: Uniform Patrol Lieutenant/ Watch Commander f Professiona/Activities: FBINAA, NC Chapter 3rd VP; NSA; NCSA; NCLEOA; NHCLEOA; IALEFI ~ VolunteerActivities: TASC advisory board, Communit Pena y lties board, Crime Stoppers ~ Why do you wish to serve on the Board, Committee, or Commission requested? To assistbohedcommunit with addressing current crime is BPS f om p r onal and professional exper- fence. The knowled e th I h ve of he county and i 's crime roblems should be only an asset to the board. What do you feel are your qualifications for serving on the Board, Committee, or Commission requested? I have served his area as a law enforc men o icer for the past 17 ears. ~ What areas of concern would you like to see the Board, Committee, or Commission address? Juvenile crime issues and crimes a ainst the elderl Are you current/y serving on another board or committee appointed by a municipality or a count ~ y. /f so, please list: n a f=1n-r~ (~ ~Ll~LS ~ ~J/ Date: 0 ~ ~i / 9 7 SEP 1 1 1991 si nature 9 (Please use reverse side for additional comments) ~p '~~""! HANOVER CO. REFERENCES P/ease provide three local persona/ references.• Name ~~ Dr. Mary K. Rudyk 2J .Rev. Jim Everette 3J Mrs. Faye H. Singletary . Phone Number 791-5047 763-2471 799-3992 ~ - ~-~-~ : Ll,~ C i ~: ~3~~CaC~L L 0~ 0 1 1991 ~;~.'I HAr';~`!FR CO. ~:.. G: NEW NANOVER COUNTY BOARD OF COMM/SS/ONFRS 320 Chestnut Street, Room 305 Wilmington, NC 28401-4093 Telephone (9 101 34 1-7 149 FAX (910J 341-4130 App/ication for Appointment to Boards, Committees, and Commissions ~, Appointed by the New Hanover County Board of Commissioners. Request for Appointment. to: ~')')~ I1L(~~ clLl~~~ (~ lp2 f ' S ~° ~~QQ ~ ` Name: ~OQnnC I ' IQ'cY' Home How long have you been a Address: i4S Wd0 n i resident of New Hanover County? _ ~~ ~leS Mailing Address: ~-{~-~' ~ ~ I P .t- ~ ,~+ ~S S f- ~ ~, c `~- City and State: I ~l'Y11 Zip Code: 2, fS~O ~~ Telephone: Home: ~J ~ 5 - 2 D Z Business: _ C-I J ~) 7!0 2 -~3,3 "Sex: ~ma, ~ "Race: w~ 17~ "Age: ~(' 'This information is requested for the sole purpose of assuring that across-section of the community is appointed. ..Employed by: ~OC1~S~A~Y 17y~21zOr1~~S ~ /1'I'C.~ /TtS Y20CYRQ ~'~'~ ~- ' 'A person currently amp/oyed by the agency or department for which thrs appGcauon is made, m resign his/her position.wi(h ...' .New Hanover County upon appointment, in eccord1e'n-ce: with Artic/e Vl, Sec. 4.of the New.Hanover County Personnel Policy. - Job Title: _ 14'SC DI Re ~-TDie Professions/Activities: ~ ~S I rkS~ (,tL VolunteerActivities: R~~ ~o1(,lrl p~ [,~(_ ~~ ~ ,/~ ,p ~ Why do you wish to serve on the Board, Committee, or Commission requested? fn ~~ ]~ $~' 0 2.C,~ _ ~ r> t M.~k,-~CcXI ~~ h o ,~,J n Q~ n b n_c~, .c -~n-n What do ylIou feel are your qualifications for serving on the Board, Committee, or Commission requested? 7~ ~ZS CX~~ ~-CP- I~i.~~~ -T1~-SC rcr~ ~'fy C-~-T <~~l ~~n'~ l~lrhat areas of concern would you like to see the Board, Committee, or Commission address? ~~ f~C.~ iG l~ ~1.Q. l o ~~~~ Stu l IJ 20 ~C.c~- ~ ,` Are you currently serving on another board or committee •a ~ ~ ~ 1 ppointed by a municipality or a county. if so, please list: (V /~ `' 1 ~..:...J~:~U ~ Date: ~ + ~ s ~~ . IP/ease use reverse side for additions/ comments``-r rr ~ ~ , ~. \. ~~.~ tom: ci:li~ __ ~ Signature NEW HAND VER COUNTY : ::.. `' BOARD OF COMM/SS/ONEf3S SEP 1 2 ~ .: . 320 .Chestnut Street, Room 305 Wilmington, NC 28401-4093 ~ . ~ ~. Telephone (9101 341-7149 = FAX (9.101 341-4 i 30 App/ication for Appointment to Boards, Committees, and Commissions Appointed by the New Hanover County Board of Commissioners. Request for Appointment to: Criminal Justice Partnership Advisory Board r'ar; ~ e: LAURA B . OVERSTREET Home Address: 237 Cherokee Trail Now long have you been a _ resident of New Hanover County? Mailing Address: 237 Cherokee Trail, Wilmington, N. ~. 28409 City and State: Wilmington, N.C. Zip Code: Te%phone: Home: 395-2101 28409 30 years Business: 251-2671 , 'Sex: FPTTla ~ P "Race: ~iti~e "Age: ~ ~ 'This information is'requested for the sole purpose of assuring that across-section of the community is appointed. Emp/o.yed by:, North Carolina DeoartmPnt of Corrections-Wilmington Residential Facility for......:.__ "A person current/y employed by the agency or department for which. thts epplieation is made, must resign'his/herposition. with ' Worren - ._ New Hanover County upon appointment, in accordance with Article V/, Sec. 4 of the New Hanover County Personnel Policy. Job Title: Su~erinter_dent Professiona/Activities: Memt-,Pr of a F~lovees Association • President of Tan_glewood Homeowners Association Vo/unteerActivities: Member of the Adult Choir of Pine Valley Baptist Church Teacher of Adult Women's Sunday School Class ~. Wh y do you wish to serve on the Board, Committee, or Commission requested? There is a dire need for post release housing for offenders in a safe envirorlrent with structure. When the women-are ready to~be released from this facility, we have great difficulty in getting them housing.- What do you feel are your qualifications for serving on the Board, Committee, or Commission requested? - I have. worked with HOC for 30 years. .What areas of concern would you like to see the Board; Committee, or Commission address? The entice mission of this board is to plant seeds of change which is my mission in my fob. I have a passion for that change in the lives who cow to us If we can help change only or_e person, we have succeeded. Are you currently serving on another board.oi committee appointed by a municipality or a county? /f so, please list: ~ ~ ~L~~~~ Date: ~,~~~~.i ~~~~ 9 ~ ~ Signature r~l~lGC/.h>L j~ ~~~ (Please use rq{erse side for additional cfomments) t NFW HAnlr'JVER COUNTY BOARD OF rC7MMISS/DNERS 320 Chestnut` Street, Room 305 Wilmington, NC Z8.401-4093 Telephone (9 101 34 1-7 149 FAX (~ 101 341-4130 Applicallon for Appointment ter. Boards,. Committees,. arld Commissions ' ' Appoirited by the New Hanover County Board of CommJssior~ers. Request fot'.4ppointment to. [~~p,41: ~5'T%l~' ~4~~.v~!>° ~DUl~~i ,~,~~ ~ - - Home HOrv 1on~ have you been a - Add/ess: r' resident of New Hanover County? _~~~~ Mailing Address I-"~~~i~/~~t! •5'f~~ I~ ._.. _ City and State: ~/t;/?j/.~Td/I~ /yC ,tip Code: !~'D9 ~ - . :. ._, Telephone: Hama: D ~ ~ /~~Q:. _. Business: _ . "Sexy ~~~l~ "Race: LyiS/~T~' __ Ape: ~' ~ . • _ - °- ~ '771u inr'arrneton is raqu~s'SPd for the sale parpose of asaurJnfl that t Crass,seGt/on of N~ community is appnrnl~d. •~'~~royedby: _ __ "A person CUrrbntlyernplDy~Id by theapency at ddparfmrnt far which thh app/icatinn is'msds, rnusr resign his/her posit/on with Now HanoV~r County upon appointment, m ems.^ordance r~rth Artfc/g V/ Sea 4 of the New HsnovrY County Persnnne/ Fbl/e y. .:.. JDb ride: . ~ . . " • .. , .:.. , . - .... ~:~ PrafessiDnal Activifiss: VolurrteerActtvities: r¢~~ Why do you wish to serve an the Berard, Committee, err Commission requested?~',rjQ~ ~ ~~~~~, rQ/1/~~~ `.9,t-~ !~`wG'~.~,l,~ d~7.G~ ~a.2I ~d,G l~?ti~,tl~ C'ir>~'~ ~ E~G~ ~,~ ~ C' doh r ~.~ sliyS_ What do you fee! are .your queiif/cetions {or serving on th$ Board, Committee, or Commission requested? ~(~y~/~1IY_,,r' -: ~ ~'~&lr~ ~iLl.~.D S&~ic~ r7~~ ~ ~C'~r~n L3lct~n~~A~`i~,v e~r~r~~sSi6.c~ A N,o 7~FF ~tiG . (~!~?!i1 J S~'y~ s~ ~ f,~ Nfn,es'~4s, het areas o concern, wou/d you like to see the Board, Commr'ttec, or Commission address? _(Jlr+ri~S~(.~ri7y ~l~~5'l~tt~° ~r¢~S~ d,~.c 5'--14CC'~xi~lt4r~~ r~~ /s~~,t,~Oc~S ~'Tle,~ c~l?~c/dir-,~ Are you currently serving on enoiher board or commit~ee.8ppo(nred b y a municipality or a ro~nty7. !f so, please /isi: J~~ r - r IPleeno uee /eyera• side for ad~t~onal tOniryrentyf„ O ~ ~q91 rJ4- r~`tiv ~t~raov~~ co. .. • J E A N Z E f2 E N E G A R UNC-Wilmington Parents Council Charter Member, 1989, 1990, 1991 Fund Raising Chair - 1989 Parents Council Chair - 1990 UNC-Wilmington Seahawk Club Pund Raising Committee - 1987. 1988, 1989, 1990,. 2991 Board oY Directors -~ 1990, 1991- UNC-Wilmington Search committee Womens Basketball Coach - ].990 Yahw®h Center for Abussd Children Board of Directors - 1.988, 1989, 1990 White House Cdnf arence Drug free America - Delegate Wz~shington, D. C. 1989 White House Con'Perence prug Free America - Delegate Oacksonvill.e, Florida - 1988 .., . . _ ...... .~~.... Mayors Task' Eorce~ on Substance Abuse. _ ~ .. - --- .. Wilmington, N.C. 1987, 1958 Friendly Shares Homeowners Association Secretary - 1990 North Carolina Cnmmissi,on on Families Commission Member - 1987 North Carolina Commission on Child Victimization Commission M®mb®r - 1985 ~_ North Carolina Commission on Mental Health, Mental . Retardation and Substance Abuse Commission Memb®r - 1982, 1983, 2984, 1985, 1987, 1988 , 1.989 Substance Atause Committed, Chair Standards Committee North Carolina Health Coordinating Council Member - 1975, 1977, 7.978, Plan Developm®nt Committee - 1977, State Medical Pacilitids Committee Implementation Committee - 1978., 1' Nominating Committee - 1977, 1978 .Council (SHCC) 1979 1478, 1979 - 7,977 , 19TH X79 • ~~ North Carolina state Health Coordinating council Chairman, Statewide Task Force on Perinatal And Infiant Mortality and Morbidity 1977, 1978, 1979 HEW' Region TV Health Planning,. and Devalopmesnt- Agency - Atlanta, G®orgia (8 states) Technical Advisory Board (ACCA) - 1977, 1978, 1979 .; Cardinal Health Agency . Board o~ Directors - 1977, 1978, 1979. ].980, 1981 Planning Committee - 1977, 1978, ].979 Review and Evaluation Committee - 1880, 1981 Nominating Committee - 1980 • Interim Committee - 1979, 1980, •.1.981 Board Secretary - 1979, 1980, 1981• Cardinal Health Agency Consumer Award - 1982 March o'P Dimes girth Detects Foundation . Volunteer since 1969._ Mothers March Chairman - 1970, 1971 _. - Executive Secretary -- 1972, 1973, 1_.974 " T~lerama Coordinator - 1972, 1973, 1974, 1975; 1976, 1977 Telerama Talent Coordinator - 1973, 1974, 1,975,,;1976, 1977 Southeastern North Carolina Chapter 8oard~ciY Directors - 1973, 1974 ' March of Dimes Maternal Nutrition Faculty - UNC=CH 1982, 1983, 1984 .. North Carol~.na March of Dimes Volunteer Advisor - ~ ' 1973 - 198A .Nominated.. by_. North. Carolina Executive: pirector`,j Hegicsnal /~ -Director, Atlanta, Ga_ ~ppointad.:•by,_,Nati.anal.;Office .in _- _ -- ,, 1_. White Plains, New York ~~ '~~ New Hanauer county Social services, _ Board afi Directors - 1974, 1975, 1976, 1977 Vice-Chair -- 1975, 1975, 1977 North Carolina Social Services,Association 1974, 1975, 1976, 1977 Pine Valley Elementary School -.. Grade Mother - 1972, 1973, 197.4, 1975, 1976, 1977, 1978., 1979 Chairman - 1974 -.1978 _ Secretary PTO - 1973 , 1974 . , ~ ~ , ~ ~ ~ William Hooper School' Grads Mother Chairman - 1978, 1980 _ PTO Secretary - 1981, 1982 Roland Grise Junior High,Sohool Volunteer - 1980 - 1985 Volunteer Coordinator - 19H1, 1982, 1983, 1984 Vice President PTA,- 1981, 1982 President - 1983, 1984 ~~ New Hanover County Schools Discipline Hearing. Board ~_ . 1981 , `= 1982 New Hanover County Schools Parent Advisory Counail• - . Compensatory Education 1977 New Hanover County SQtIOD~,s Health Education Committee - ].977 hlew Hanover County Schools PTA'Council - 1977, 1478 , N®w Hanover County Task Force on Family Life and Haalth Education - 197$, 1979 lmin9ton's Girls Club Wi , Board of Directors - 1970, 1971, 1972, 1973 ; Cub_Scout.Den Mother ~ Troop 213_den 6 - 1975. 1976 ~ ` Wi3.mingtan ~'ayoettes - _ - Director - 1966 'Vice President - 1969 Jaycetts of the.Year - 19b9 : President - 1970 Morth Carolina Jaycettes Regional Coordinator - 1971 .-North Carol.zna Jaycettes Five Outstanding Young Women - 1976 • ` North Caral.ina JayGSttes Award of Honor - 1976 Pine Vall®y Baptist Church - .-t<indergarden Committee - 1972 Enrollment 78 ~. Kindergarden Committee Chair - 1973, 1974 .' C~ordinator - 1972, 1973 - Nurssr.y . finance .and Building Committee (1000 member) 1974, 1975 $350,.000.04 Sanctuary .Sunday School Teacher - 1974,-1975,.1976, 1986, 1986;-1987, - ...1988 •..-.- ... .. - ,. _ _ Platarial Directory Chair ---..:1979 - -_ - --- Public Relations Chair - 1479, 1980 . Sunday School Clasp Offlcar - 1980, 1.981; 1982, 1983, 1984 '. Youth Department Director - 1987, 1988 Nominat~,ng Committee - 1985.;.198b, 1987,.1988 NF'W HAND VFR COUNTY BOARD OF COMMISS/ONERS' ...320 Chestnut Street, .Room 305. Wilmington, NC 28401-4093 ~ . Y E • 7e/ephone (9.101, 341,'7149 ~ " ~ ~ . • ' ~ ~ FAX (9'101 34 1-4 1.30 . ~ • . .; ~• App/ication for Appointment to" Boards, Committees, and Commissions Appointed by the New Hanover County Board of Commissioners. • .. ~ ,. Request for Appointment to: --~_( ~'(~ }~ ~(' . ~.~~ ~, . ~~~~~~~~~ ~ , V ~ { 0 ~r~,~,~ ,~- Name: .~ ` ~ ~~~ ~ , ~ r ti ~e ~~(~~ -~Z -l ~~^U~ Home How long have you been a Address: ~~ ~-'~{ ~ 12g CQ ~ (~-(- ~~ , resident of New Hanover CountyT _ ~{ ;~ Mailing Address: SQ.n~ - ~; City and State: _ (,C9 ~ L~ ((mil CF I Z~..1'- ~ ( ~ Zip ,Code: ~~v~~ -. Telephone: Nome: _ ~lV - ~~ ~ •'~j ~~ •=$usiness: _' ~j~[~~ -7~' - ~~R~~ -Sez: ~ 'Race: ~ _ -Ape: • . , I ~ • . 'This information is requested Jor the sole purpose o/assuring that a cross-section o/ th'e community is appointed. " ' i -. .. .. . --Employed by: C~11P~ - ~~ i 1 ~~ .1 ~ ~ ~7 e~S L ... P Y P Y Y 9 Y P P 'A arson currentl~ ~ io ppointmentem eccor~ance with Artvc/e v/, Se~ 4 of thetNewHemustresign h'is/herposition'with ".. New Hengver Coun u on e ' Hover aunty, Personnel Policy. " _ ...: . .. :. .. ,- ..:: ,.. Job. Title: -~J{- ~) ~I~~-~ l ~ 2 ~ ~'~ ~~ '1 ~ ~.~5~ C.~~~V~ _ . ~ ., ~ _ Professional Activities: ~.{ ~ _ _ }-- c r ~ ~.) 1 ~ ~ •. i ~ .C ~ ,i -> ,VolunteerActivitles: ~~AJ~ ~ ~ ~~~ ~ C~2.(Z~}~I~ L~P~~~-` ~1~f~1 ~.`~~ Z~-~~ Why do you wish to serve on the Board, Committee, or Commission requested) ~ ! ~~( --t u {~~~ _S~>) L 1 TI~~ (.l~ 1 l ~-{~ t,U {-f (CK ~~ (~ ~L~(~~ L -~~~C-F'~~ ~ ~ f-t~-\ C,~ ~~ ~~R~ (Z~ C_L~.t ~'D_ ~ ~r ~E` '17> I ~ Ct~f tZ.u ~-: c ~-t r What do you feel are your qua/ifications for serving on. the Board, Committee, or Commission requested? What areas o/concern would you like to sere-the Board, Committee, or Commission address? ~j~ 1/-(=~,( ~~ ~~ ~~51~ r ~ ~ ~r~ • ' ~~ 1 ~ ~ r LQ`-Y ~~ 5 (1 T l~~ (2~~ t~ ~ ~J t~1 r' Are you currently serving• on another board or committee appointed b y a municipality or a county? if so, please list: r.~,..r:r r;;; i Date: `- (Please use re r 'de f edditione! comments) -•..~Ub~.~~ 1L•1998 Signature r ~.,..__.~ r i/i i` i.:15 OVER) ~. ... , Jo eph D..:. Thornton, : Jr , , CLS . . EXPERIENC'$ ' Cape- Fear Investigations ~ 1995 to Present " President and sole shareholder"of private investigation firm located .': in Wilmington, North Carolina.- The firm specializes in civil and " criminal investigations with a client. base of lawyers, insurance -, companies and private clients, respectively.. New Hanover County Schools •"~ Case Manager; Willie M - Unit wide. 8/96 to 6/97 . ' Substitute Teacher 12/95 to Present Lawyers"Investigating Service 1975"to.1995 ~ + . President 'and sole shareholder of private investigation. firm located in._Portland, Maine. The. firm specialized in civil and. criminal 'investigations with a client base. of .lawyers, insurance companies and private clients, respectively. ~ -" Hallmark Security, Inca 1987 to 1992. ' President and majority stockholder of a security company located in Portland,"Maine. . . .. _ -._ PROFESSIONAL AFFILIATIONS National Association of Legal Ihvestigators (NAZI) 1985 to `Present. Director - Region.I ~ ~ ~ 1990 to 1992" ?~ ~~ Certified Legal. Investigator. `1988 to Present . Written two articles published in The Legal Inver i~ nr magazine:, ~ ~. ~. EDUCATION ~ attended 1971 to 1974 ~~ ' University of Maine School of Law . - - ~, 1971 Graduate B.A. Magna Cum Laude ~` -' English/Philosophy Double Major `" ' Boston .College 1967 Graduate Magna Cum Laude ~ ~" Cheverus High School" '" :,. , ' ;" .PERSONAT NOTE...."', Traveled extensively throughout the United States„''Europe and British .Isles.: Enjoys skiing, sailing and golf with wife and two children. _. . ~9 • ~ t ... ~ Take t ~~ l/ .a ~ • • .. . ~~ ~ ~y Joe Thornton Jr., .CLI ~ _._ ~ .. -~ ~ ._ -. ~Co-Chair, CLI Committee` ~ ~ ~ °~ ~ ~s' ' here were a million people - methodology, I learned something in Maine when I grew up ~ ~ -~ ,. writing-the article, which is an impor- here .(1949-1967). Having tant part of the CLI examination pro- 'graduated from a Jesuit high , _,,..~ ~ cess. A .? f ~~r school in Portland, I ventured.out into s:~.;,:<~,~ the world (100 miles south of Port,- ;,. ::`rG' Learning 1VIor- e - ' land) to `a Jesuit, college in Boston,. •. - ~ Then, I;was provided with a syl- latermade famous by the exploits of '6'Jj ~,.' - .tabus that consisted~,~of four or five ' 'Doug Flutie in the 198Os. ~ ~ ~ ~ ~"s~' -: ~'~;,.~, books about investigation. I diligently After eight years of studying ,;~ ~' ~`'~ ~ ~ read them and, in the process, brushed Latin and German al Clicvcnts. I Iibli ~ - _ ~ up on sornc areas oflhc law and invcs- School and Boston College, I returned,. ~ , ~-';.~ . tigation with which I deal only infre- to the provincial state of Maine iii ~~ ~,~; ~ ~~ quently: -A,gain, L,learned somet ing ,. _ 1971 to attend law. school atahe Unt , - _ through this. effort.:.:. versi of Maine: I hated law school ` =- '~ ~~M{;~ h' >,.. ~f~ ~ Finally, Dick Day provideti~~e and finished only four semesters on i ~~\ with a,sample ezam~.to review. I felt the installment plan between 1971 When former Region I Director Joe Prepared,buttraveledtoDenverwon- and 1974. During that time, however, Thornton. took the CLIi exam, he Yearned-~. during how I 'would do on the exami- Iwas ex"posed~to private investigation more than he thought he would about his nation, particularly_the:oral part, about Through an attorneyforwhom Iworked profession as an investigator.. ~ w]iich I remained vague (probably by in that capacity. I loved it and con- design on the part of the examiners). 20u eao ~~~ork.in that field today, some : ,,,CLI; AlanA'Hart, CLI; and Dick Day, ~ .The ~ezamin'atiori`'was fair, compre- y rs later. CLI, I decided to take the plunge. pensive, long and tiring. Although I pride myself in my I actually enjoyed the process Reluctance written rcpoits, I:~had .not written:a~' despite my fears'and the natural re- Whatdoes myeducationalback= white pa'pcr for some 12 .years (since ~ luctance of all of us to cram for any- ground have to do with the Certified Those dark days as a law student). I thing at our advanced ages. Legal Investigator examination? Vol- , ~ chose, a subject,_researchcd.,.it and '+' ~ ' umes. I approached the CLI exam wrote the article,- ,~yhich. ~uas unin- _ .Friendly .Interrogators 'wills some trepidation when I first spiring and very rudimcntary,:''I am ,- During the oral portion, I was inquired about it shortly after joining sure that those who graded that article asked to take a statement from awit- NALI in 1986. At that time I had been: , had a similar,'asscssmcnt of it. ;: ness pursuant to a hypothetical fact self-employed as a private investiga- .. - .pattern. Having taken thousands of tor, running my own agency since Familiar, Topic these during the course of my then 11 1975. I knew that I vas capable in my I chose a topic, photography, in or 12 years in business, it was not a field and thought that I did not require which I was interested. I had a lot of terriblyadainting Task.. ;The ethical a CLI designation to confirm that fact. practical experience, but very little problems posed to me by my examin- But after talkin with Dave Watts, : technical knowledge ofequipmentand - ; ers, the late. George Posner, CLI, ~ - _ .~ ~ .. V~ $ THE LEGAL INVESTIGATOR, NOVEMBER "1993 Lynne Curtis, CLI, wci-c comp}cz: = '° ~ ""`~~ • .:~ ~ :. .$t~1O~grS~11~ ~,VI/grd " Both made me feel very comfortable duringthatprocess.Presumably,since : ~ ~egd~~nes Annovrn~ed I passed the examination, I answered ; thci~ ethical gi~eslions.willi some de- ' , rec of candor. g " By Steue~z W. Mc1Val y, CLl - Spreading the Word ~ ~ : SCttOlarship Committee G~hairpers.orz The CLI designation confirmed' ; Scholarship applicationswill be that a parochial. Irish Catholic kid accepted starting Feb. 1,1994. Dcad- .from arural state, in the Northeast ; line for application, with all required could hold liis.otivn with the bright, attachments, will be May 20, 1994. articulate membership oftheNational you can obtain the 1994 scholar- Association of Legal Investigators ship applications from. any Regional ' from coast to coast.. When I returned Director, national ofrecr, the Execu- to Maine,initially I was reluctant to tivcSecrctaryor,IhcScholarshipCorn= - ..use the CLI designation, thinking that : ` mittec Chairperson (Steven W. • .., no one"else in my state would know lUlchrally CLI, -c% IntelQuest Inc., what it meant. I overcame that reluc- 1002.5 S. 1Y. 91 Terrace, Mtnml, I'L tance and beganto use it. I am educat- : 33176). " ing the trial (awyer•s in the state about Remember, the numberofavail- thcdesignation and encourasing other able scholarships has been increased., " investigators'to joinNALI and to com- plcte the CLI exam. ~ ~,: Consider applying to take the t~~-'~,'-: - .. •, ~~. n-•' _,~,c. exam at our Mid-Winter Scm~nar m ,,~~,~ ~~,'~ '~-3 _= "~/ Dallas or at our 1994 National Con- ``'; ~?~~-~ ~•~~•- vention in Buffalo, N. Y. In ourcapac- •- `~ y."'~~ • ~ i(y as co-chairs of the CLI Committee ~~`. . this year, Lynne Curtis and I will try ' ' •'~~ ~ t ' ` '~ ~_ ' `\ to make the cxpcri'cncc educational .and rclati,vely pa.inlcss (unless, .of .: ~ " course,. a. prospective candidate has -` ~_` ~.. ~i _ bested me in a NALI golf tourria= ~ _ '` ~;..1t,j ~~~~ -' y~ , ~~. _ Y1 V° B}- the .way, tl~e population of ~S,'~ - '` ~1 ~r~ iVfauic rcniains the same, sonic .25 : ky years latcc, but within it, there is only : (Lefi(J 1993 scholarshipwmnerMistyHackettand NALI mernberAl Wolfe• (Right) Region one CL1, _® •. VII Director GaryVencill awards a scholarship check to Leigh Anne Whifney. " ~ 9~3-94 Committee ~hea~rs .' ,- AdviSOrti: :Alan Hart, CLI Editor-Puhlishcr:GraccCas[Ic J~ck'i~tuna}~„CLI CLI: Joc'I~liornton, CLI, and Llcction:'~R~bcrt''J. `-`I3ucl;" ~~"i~lcotr~I~c,Lihrarv: Bob Lvnn~ Curtis, CLI Wit''".insII Rubiil Cnrlfinuin~iEduc~ition: Rob- :1r3vcr~isind: L~d Roo:ic_,,'CLI Constitutional :~mcndrncnt ert °~rLc; CLI ~ i Conij~uter-.Resource: Ron IZescarc}i:~-~lanHart, CLI Co n~~c n ti o n Site: :'~I d cn '~~1cr~acl 1, CLI ~c~islati~~c:'.Tack Rccd, CLI 1','olt~, CI I,anc]JohnRcnnert CLI ~1lenibershih: Juliann. Osborn Scholarship: Ste~"en;~~lcNally, ~~ I)iscij~linar}: I~1lchacl Kern Editor-Publisher .1~~'ards: CLI , - ~ ~1 THE LEGAL INVESTIGATOR, NOV~h1I3'ER 1993. ~ g from h~~o to four $T,500 awards: Ap- plicants can be c ildren or grandchil- dren ofNALImembers (in good-stand- ing, whether active or retired). Since -the purpose of the award is to.provide recognition of achievement, the can- didatcs' financial ability. shall not be a factor in the selection process. The next committee report will describe the scoring criteria and pro- cess. It also will identify the commit- tce members who have devoted their.' time and effort to making the NAZI scholarship program a success. ^ i .Y '_ ~-.'~~ ` ~l The politics ~ Maine s of peat top .private eye ----- ~- :~~ -~ -, ___ J.` ~ { pg.16. ~ ~ Pg. 25 -~- ` ~~. =-- f y T----- J~ ~ % _ ; . .~ ~~ . a5 ~ .cents- , a'~L csco>_is E04 THE WEER lEGtNNING JHAT f, Vsl r J : i nc .. l r. 4 ~' ~;~ ~}k ~~~ ~ .. ~ Unsafe trucks and ~' 1 J ! ~L t . :~ J t . ~: ~~ ~ - drivers = .. , ~ ~ c , careless A. 1 .. ~ • i. ~t=.JV t- _ ~~~~ ~~ - - can kill: ~~ ~ o - .C ~ 6+~ ~~~.,~~~~'~~ 1'I y-Jt~`'af,~~•:.~~S~t T ~ ~ t ~ ~ l t~ < •' ~ - 1.s c ~-r r+: .t .~cf~~i'ti <iF4sk~ r t j~~--t ~+~'-~ ~ ~~ .~ !"Ks r ` ~ r, ~ -Y f r,7t r ~ -. h ,~ .. -. r ~ 2 ~ ~ ~ ~ C zC t7r• Y~` ~` 1~ ~ kid.,: +. w. ~ _ -ems r ~ _ ~ a.~-n.- ~K. -,~'-.-~.~a 5~~~~ •" .~~~~1~~~' ~5A~4~,;~, ~~ J ~~~'^~~"~r..1 `K.t~`. f`L •r"' , ~ .. ~ .. ' t f. '- ~ .t ,-~ ~{ moo'- >~~ ..? ~ .! " ~_, ' ~ ' '~ .S i z ~ ~p~ t y~:d~ _~ lti ._ I` .riff ;J. ~ ..''sr ,7Ca-"rr J~ ; t' ~' ~ ; ~ ~~re:e!1i ~ '~ tod,•. ~~a~ ~ 1Y ~ l~tr ~ _ .:~ ~ j ~ ~'j 3,f~Y vlT'1 % ~`tq~" ~ ~ ~t J i _ }(~" : r- r s~ f, ~/~I "~`.~''~-~,tr..f[S' ~ . r_ rlY~7 ~ t t .~ .~,;~~ tom.. _ «~'_t~~f.E:~~~'~n: ~ ! rµ' ~'. ~Y y ~ `~:~~ = r „~"^""_J ~~''~' _ . u ..st r ~c-!y ~Y fr1~~~ yyy .'} T.;' ~ ,~1r ~ ~ _ '^--,.•111»>rrr'.. ~~~ _ is=2'_.. ~~..F ~:r ~~ .t,1'f' `~ ~! ~. ~}' 3 }t ~s?~? ~ r lj.'l .Y+~ y`'' ~" T 1 .:~"S .}a ` ~ ~; ... - '~`~~ ~'', rt.~.ky'S'r ` T~.'r"3'"~{~f`.+jj;?.1{_?~t~; ~ -x;+ ~`C;~•~ ~ ~C d ;'~rti -+` '•~~ !' ~'.~ 1 `i1 2 I ~ ~ ~.~ ~l ilF ~a.~ .'_.. "~. } `_ ~ yJ ~~ ~h,. y~Y.-~~'. ,. ~ cr, 1~... L 7 z°~ ° to-~ ' ~.` `f3~ f`~i~tlVJ~~*'J++cat r'i~. {- _'r~''~~3~`.-.„<" Ct~~~a'~g°L~` ',~S ~ ~_ ""' ~~',,~~_"~ ~.L17~ ~ , ~~ •..c:iY~ ~; ~~~~Sb?G~C' 1-. c.._,7,:... r ~Ew ,r ~;' ~~~r ~r _ ~. .}~, ~~d~y~~.Y `~, ~.,1sJ.~.~T .T ~.• .r .~, ~ .w'y:, ~~~-,yj~ _.n•~Y-'S'}~:,+~'I ~s~-o++~?){ ~~~':~ {~ ~•i.C';-`~Y~"~y`Tir/`,.1;'~ gib" ~~~~~~.,~~*~,~,~,~r!.a'y}~; ~ f1~C~~ •/.,,~~: ~;w.~,.:,;~ ~:~ ~ Y~ ° 1{` n ~~~a~ Nt uX7- J (J ~ '~ ~ r~,~r1t.:~"'- , ~ 1. ~tiv ~ • J ~= .t~«~ir ct-ti-'~r, .its-r- ~' ~~s1~~+z,~~}, '' -'~';x r• j.~1~.~~~~~x,~ ~ ;~• ~¢r'•~ •1_~;. •cP>~ j_ ~ t- •X* `~ ~7i.~ tiaTlStf~~pN~ll~~r~ h ~~~JR -~~~~~.1~ ~~ ~ ~-_p; t - --- - -'-- _ ' ~,. _; Photography tY,?`ls7gphrr AyrrJ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~' ~ ~ „ . _. t•~r~• e,k;~ r. ~~, . ~ *. . .5 .r 1AYG .. t Y i.. 5 ri.'.. ' Inside: ~. Th - ~ :. O :,~,. e arts. ' . .... o. . . ;_r;;;:;_ _ •reviews, gardening,:and calendar of events . • .1O E . . . . , OR IOT~'p ~ , ITT .:Y ;~ , . p - .: ~ . _ . I. ~. . :~ _ ~. - ~~ . want to know ~r a ,y i _ • ~' what he knows.. • r. •. -. _ ~~ , Joe Thornton rays he is rsscnlially fnlcreslcd in answering jus( one queslloa - wha! haPPcnrd.~ Guilt and innoceitce arc Jor the courts to decide; hr's irueruled.in the facts. HE DAY TRUASAN DONGO and "that willslandupincourLNo,Idon'i ' ,. Herbert Schwartz were acquitted oC anyihingloe Thornton knoa~a. wanitokoow - , avrder and being an ecceaso irtaieta. In a atrartge may, that's what he does fora . Lhe. fact. of murder, rea zY before Joe Thornton cut his investigative teeth on Lhe Lvmg now. pectivelY,'in the 1973 Pownall murder cave, At the conduaion of the Joe Thorntonlooka - shooting death of film director Jon Pon-Hall, I w•aa .Don o- ~ [.bough be could take care - ~eittinginn.Portlendlounge with Joe Tborn:on,one fished Le hwasiz ~~ to-Me of himself, but he's Hots bully, notnio - - of l}ie private det<ctive~ who had worked on the i en Invea Y of 1975, he eatab- ~ 3g he 1e a boyiehiy handsome, ughguY•At ca.e for thn dafenee. A... the t. neriminnland ineursnee de en ework. lle dots foR able ou ~~lak. Penwn• ,. poe trial victo Y rtg man. Nis thick head of d~zk hair and . celebration wen[ on around us, we eat tel rY dcfenee attorneys whaEthe detranLmust~che give a slight! icon king about police do for prosecu- ~!o his otherwise rn Y odaaGc touch ~, the Rood old deye, but inevitably the converselion w ra. (IL is mere coincidence, he se ~ iuervntive appearance _ .ten turned to the crime. K' endow looks direeLl ~• that his office $ouibwiek suit, a"••ded loafers. Welkin ould the murder ever be Y across the Portland Public atreetsofdowaLOwnPortl g!Jongthe solved,Iw-ondered. Wouldwecverknoa•w~hodidit? Satety Bwldtrtg pezk'ng lot et the and;hemightbefakenfor ••1 kno.+ who did it "Joe meat dalective bureau. pOLce depart- ~ a proeperotu investment broker, a replied confidently. whet bed 1 Apparently Joe is good at ezeeutive, Jtutiot bank Il+oncedy don't recallwht thtr whatJoe said nczt ~ oea, for in the peat 12 enzs be PezhePo an up-and-comi came in rea called upon to inveetigete 30 murdera.ewd hie fee ~ ~ beforedhe veered off to wa Loa ru attorney, poneetomyeilence,thelookppnmyfece,. (SSOnrtbouz Y caz°ezinthelaw or a question Irotn me. All I remember Ia the chill, com peLitora. Not bed fords ormter Chrnrus High forcemeat back bernme the-fast licensed • "You don't .cant to know." he acid. ~ - private invetigatar in Maine without ~ few en- Joe wea•rigbt. I didn.'t want to know.. debater and one-Gene Columbia Su grottnd. the kind of knowledge I could live .+ith. Shut Joe's ~ PGZma?ket _ Attar graduating from Cheve ~ - ba8boy. attended Boa ton zus in 1967, Joe chigmatic words hove eta Whea I fast met Joe Thornton he was College, graduating ~ - Y in `° ba spoke them ~ nth met I atl~e dozen at Cheverua H' b • student Inuda in 1971 wiih a double major in En~j ~hNm ~ - . t.o Joe, ~ School,. in Portland. and one of g a and You don't want y xnow •• 7~~t words X106° handsome-young_Giholic- Philo.ophy. Having duiiagviahed himaelfaudem- and-iie,for which the school is famo~irarHe wane an 1Cdlly all his life, he then entered !aw school when • en imayi^=zY balloon above his heed. Md ouie[anding scholar end debater, but I slip tend Lo i ju•a..nokilledJonPow-naJlthettdon'iwant ~he discovered he did not enjoy'eitber ihe.subjcct to i...'o.v. For 1 have to _ think of him m a gentleman ra.vdy.. Wasn't be matter or Lhe disdpline. Alter one semeaterat the - xnowa few enforcemente thou 'eetaleoehink het alweye getting into fights beck lhen7 No, that was UniveniLy of Maine School of Law, Joe lulow, Lhe burden be' Y his best friend, now a prominent local attorney. went off to sell advertising. Eventuall quit and 6 3' trrg knowledge without proof bylziendatbatbehadn't Y, convinced. - •'I just went along to clean up afkrwarda," Joe given lewachool a chance, . . _ .. - (Continued oa. the aeSt prat) ~ - t•w1+t rests, ruoar. aQr a,nv zs. ,. - - - -~ ' ,. ' } MAINE TIMES, FRIDAY, MAY 8; 1987' ` '• \\ ~~~/// ;.~ .. .. I (CoaLinued from the provioue page) .. nt~19 `orD rte moreaemeaten,droppingout using law school, however, Joe got _ _ _ ~ Ut Lhe truth ia, only then an you back into pts of guilt and innocence " (ocvatdtheirauapicioaaonPeUetietatt6aLime but his first ezpoevre to detective work. "I guess my deairrto do investigative work stems . Beyond good and evil? 1~'ell, yea, in a certain cease Joe does take avalu u ! , Pelletier wasn't charged with the crime. ~ 1980, ~C attorney general convened a grand from reeding the Hardy Boys aeries, ee cornyne that might sound " explairu Thornton "Wh 1 i e-neu a e information. Ln teC he u pProecb ~ Yn objectivity is one his l 1urY Lo bear new evidence in the Miirpliy case, but the jury waa not asked to vote oa i di nt , - en was n my second semester of law school, I sought out Dan most va uable investigative naeeta. "I have a greet tool," he ae a of his Y point o! view , an n ctme Thenlast year, the grand jury met again and finally . Lille p y lone of Meine'a, to criminal defense attorneys) end Baked him how to get into criminal , "I'm a fact finder. I don't care how I come down on any Bide of an issue. Someone might tell 'W indic4d Alan Pelletier fot,the 1~-year-old murder. The deciding lector in Lhe 1986 indictment ap- inveatigetion. He put me iri touch with Lee Jobin, who was doing a lot o! work for Lilley et the ti ~ me, e want to prove come:king,' but people in hell want ic t I' peered to be an eye witness whostideniity was not disclosed. The myeterioua witness cl i ed h me. For 18 months, three semeetets, I worked for Jobin e wa er, Loo. mjus:ouLihereaaking thequeation, 'What be pyened?'." a m to ove been with PelleGez Lhe night Kathertne Murphy ' doing basic .legwork, grvnt work, surveillance, hacking down leads so remote Lht wo ld 't l The eeee that Joe lints ea his "biggest achieve- " was killed. ' y u n rrsu t in anythingfrvitfuL" meat -- the tecove.-y of a Rodin xulpture stolen from the Felmoutneatate o! Charles Shipman T THE TI,'~fE in order to get.a private Payson = illustrates the value of neutrality to an inve U t HEN Dan Lilley took on AlanPclleeiei'a ~Tdefenae, be hired Jce Thornt t i - , mveatigator'a littnee in Maine an a p-• . a ga or ... as well as be value of luck. It etema that toe had been 13irrd on b h lf f h on o n _ veatigate Lbenew-'developments. The-~ plicant bed Lo be 18"yeah old, not have been convicted of a felony,'and had to have carved e a o t e delendantin.tbe 19i6tnurderof Anse Holt Payaoa, .the eiater of Cherlea Shipman Pa eoa I th key witness turned out to be a friend of the accused who had previously teeti(ied Lhat he knew nothing one year as a le.v enfozcemenL officer. Joe managed y • n e course of his investigation, he met Mr Peyaon'e C°*ttak of the murder. Appgrently, ea a result of witneeeing to convince the governor's executive council (the now-diebended° body which then controlled th . er, ~ who asked Joe to itep his eyes and ears open an accident in Florida in which a girl wan struck and _ killed, the wiintaa had flipped~out nd:c nf ' e licenses) Lhat hie two yeah of few school end his regarding the stoles sculpture: Aa luc]c would have it ("pure coincidence; I can't take an e l di " a o eaaed lo FlorideauthotitieaYbathe knewallaboutthedeath '. experience working with Lee Jobin mode him at I y r a cre t ), Joe was meeting nth a dicnl in an unrelated of Katherine: Murphy. Aa Joe tells it, the key ' wit coetnequolifiedaearookiecoptobewmewpriveto deLCCLive. ButJce Thorn ton's real queli(icatioru eriminaleaagetandingineparkinglot,whenasleek e ort d ' ness now claimtd that ha and Polletiet end a third men had been driving around drunk i •~~' - ~ , are inherent. "I think Jce'e greatest asset;" Dan Lilley asya " p e car rove ia. Thornton e client ceaual{y mentioned that the driver oC Lhe aporU car "has e bronzeburied in the ground and is 4 id , acc • ~ , r.. ~ • dentlyhitthecoed(naihepolitthadeurmiaed),end ..~.;~..,, the third man-had jumptd out and beaten the girl today, islhat hedoes'gethiaman'oiwoman,aethe a a to move iL . It's two hot " to make sure she a•4, deed and would not be able to ~' case maybe,intheeenaethotheieebletointervrew people l.don't think any othet invgti et . ."I asked myclient,'Doyov.ahinktheguywanU 't l ' identify them. Joe Thornton heard ihi~ story {oz ~ ,bimxlfwhenheLrnveletiLoFloiid t iii e i ' . g or, any attornej•,even (IJ mysel(wouid have been able Lo oae litbecktoPay-son? Heepid,'I don't know, but . 'I~can find out."' ~ ~ _ a a t rv awtbe newatai.wiLneaa. ~ - ' ~~ ~ ~ '~ -' inierview.~ Yoa take a rape or eexuel abuse case ~ ~ Thornton ways tfi~ man he talked tq in Flonda ' where the victim is very reluciant to talk 20 anyone on the defense team.Jce Thornton stands alone HUSTHOR,'v^ I'ONairan edfo P was a cocaine tour and dealer who had bean in and ~ , outofpsychiatrichoapitaLsenddrvgdetozifiwLon among investigators - and I don't know whether. it's his. tenacity of hie penonalit that's hih secret Y , g r ayson hbuy bsck bin Rodin "at a fraction oC w t it " cenLen. He told Jce that he had confeaaed becatrse } o! a recurring nightmare be h d b h i . - in being able loget in,ait down, end talk W people. a was worth. Natural) authori- y" tieawantedtoknow•whohadatolentheworkofart a een ew ng-But whenJoe inked the witnesswhetherhe had ectuall who,b theve Y ryneture of the eitua Lion, can't stand , butJce wouldn't as y. When subpoenaed-before a bttnwithpelletierihenighiofihemurder,theman ~ anyone from the defense team. ~ "His seco d t s ~ federal grand jury, be refuxd to testify. answertd, "In~my wind I was." - •: ' ' o ' " ir n grea e t asset is that he is excellent ea a aitneea on the stand. Hies image portrays him - "When you buyme,youbuymyeilence,"beaaya. "Query: How many a:atuea am I i v e d n , . } t normally ahem internews.with the pro6eartion," aeyd Dan Lilley, 'but imihis ease ] ~ and rightfully,so - e, an honest, truthful guy. He calla 'em as he aces 'ea. The jury believes him " go ng to reco er if I spilled my guts to a federal grand jury?" A a ., . told them,"We can't wait for you Lo put ibis guy on tbeetand.'Jotgothim Loo e L . When Jce began his career as en investigator, e r later, the cut sit was arrested as another eh Y p ~ ~ f e i b p nup oLhe poinLwhere c ,.'• it was obvious he'wm crazy." , , Dan Lilley and Caroline Glassman, wow a justice oI the Maine Supreme Court, wtre bin rims p ryclienta. Tbc reaeon ' tbe liee wercart fi den the ~ g sculpture:' eeya Joe "ia th t th o du nt t}i"etrsiaj. Alan Pellaiierwea found not~atify s ~ • gushy • ~ •~ Justice Glassman has a similar appraisal of Th ' ,. a eir ci tive was ~proeecution. MymouvewaerecoveringtheobjecL" , inJa ua ofthiayeu. ~. ~, "W ' ornton s skills. "He did a marvelow job of inveaGgaiing which Joe believes that t!ro ezceedin 1 lint line bet- weeaJuatitt and T:vth in id h i a ret rYrng to find out whet hhppened," nays ` Jce. Thornton olhia criminal defense work. '7i my : ' • fre uentl q g q y ' re aired fittin himself ,into an " o ~ v w e eno ~ P P law enforttmcni authorities. ~In .his view the clientis guilty; iL'aup to.Lhe state to prove iL In an i environment, says Justice Glassman."'And be «riainly made a good rvitneas on the ntaad. I really , anxiety to arrest and convict sameltmp blinds police officials to the bi i L egreg ous murder where someone is eattght,. red• banded,allmyitileiatoaee,elohgwitb.ihedefenae think he is a to inveati ator." p 8 Justice Glassman recalle•tbat-the•firaicea h ` g p c Ltn '- ^ - 'The police sometime's Ldhe a myopic view," he ~ " ' ledyei; thef the pennon gets a fair Erie). The rvb comeewhenyougete wane ihafanotobviousl clen e s e hired Thornton to investigate involved a woman ' says. They tunnel L~ and foctis on a euapect too , quickly.to he ezclvaion of~more credibh valu bl y t and the state in trying to.proaecute aomeona. My,' ~~ .' who had been fired after being acrusgd by a fellow , a e; end quality eviden~e'elaew•here ' ~ • tole then u to ,find and present' areal peLOry•' ' cmploytc o! stealing money from her employer. ~~ . Aaanexam leoCofliaelm o-r Thozntoaeit evidence. ToiheeztenLthecopadon'tdoagoodjoh, " - What impressed Gleusmsri ns'•h~ov~ ezhnvative Thornton'einvestigationwes Joe even.interviewed es theunsolveddeethofColby'CollegceocdKatherine :• ' •Muipby Katherine 1+f r h . f d b - ,3heveeomethingLodo: Siill, Joe seems to pride hiaeelf more on the ~~':'•"~'~ = the doctor who had delivered the woman: On the . u p y. oas oun eaten to ~deeihon thcedgeotthe WeiezviJle.rnlle scam s• thoroughness of an inveatigntion than on t.he~ a: basic of the character profile Thornton wen able tb assemble,thee)andcrcnaereaultedin"are'aaongbl Y u in 19?~1. AL first eutboritiea thtoriud.ahe had been hit 'bye cerand lavnched e sea ch f obi d t • ` outcome of trials, t . 'Thera hasn't been cease Pve worked oa".he " good settlement." ~ - ~• "lnformationiaas.ecredtrvet,°aeyeJoe.` Peopla , r or t-en -run ~- driver: The day after Lhe murder, bowe'vez,~n young Ioulman~nam dAlu Pelled e 'saga, where eomtone'a apivag a aurpnse'.vitaesa I ^bould -have uncovertd in the 'eouraa. of an . . , don't bare )heir soul to you lightly. You needlhe- ~ e bilit to talk to o le, ilia abilit" Y PCP Y ~ get people to e n er ppeaztdaitheihe Wettrvillepolices4:iontoconfesaihethehadsetn a man it. kin h h invesLigntion:'Andherebeatopeioknockonw•ood. - ~~ ' I-sai.en~ng to Joe'a Lalea of murder end mlvhem u ~ •" 'lruet you, Lo believe in your: The t i th ia. a. great ~`.• e c g. L t women,t ttaight before ind ~ rt turned i:o Lhe aceae of the mme where be fo d aL ones faecinatirtg and repulaire. Of.eoune, few ` mot vator.Iemgenetallyinterea "in'tmdingout '- ~ . . un tba body panicked, and fled Polios'officiaL ,. ,. - ~~~~~ ~ ~~ ~ r •r ~4 ~ , „ -. - , , Y ..~~ ~' MAIN ~ ~ • . E TIMES, FRIDAY, MAY 8; 1987. j . , ~~ -! . . :~~ ~ i Joc Thornlori rays he _ ... s ~ ~ ~. -. _ i first. became inreretted '~ ~t+~~ '' ~~ , in,dcttuivc work ai a ~1 r • •" ' ' ~ ' ~° - ~. - boy7tading the Hardy ~ "'~!!'~^•.'' Boys mysteries. The ~' ~% books behind. him run -'. _•_'• :: the ievestigarivc.gomut - ~ ' ' jran-hoard-core realism ~ ` t - Invcuigalion and _ _ - ~ ~ '~ ' I'rcparalion o! Criminal h~ ` ____.. _ Cases and Electronic .. - ~; ~:~ . Survcillancc - ro ~~ ti-7 ~ ~ - r •* - } hard-Loilcd n _ j \ ~ 'F ronranticisn~ - The • ~~~ •~= r Novels of Dashidl _ Hammett, Shadu of - Travis McGcc, and Farewell, tity Lovciy. .k. ~ '. - ~y.:. .xY.~ ` enforcement officials and prosecutors hove Lo deal 'T'hen there ie a phone call to a Ioca1 ettorne who himself doin . nforcemenat offs cola an proeecutora are the good 3a L'ying t° find a client who skipped out oa him yeas, but after that he d like to step beck,lmanage • guys. Doesn't it et to him, rnnetnnLl wor without paying the bill after Lhe attorney bed his buaiaeaeea, and work on improving his golf ..behalf of people eecueed of viciow erimea7~g oa cleared him of dntnk-clziving charge: Joe's assts- game. - . °You can't help representing the damned with- Lnnt hen found the man's estranged wife, but the The only field work of the day taken Joe a long out being cast in the black hat rola," Joe replies. man himself is now somewhere is Florida- .vey from Portland Lo a remote jail where he u Lo "Some of the nicest people I hove met, geauihely meter dictaiiag a teLter to the head of a major intarviewaninmate.Theinmatehmeeatwordtoa xaaitive people, are criminals. There are good GOr ration who has hind' him to inveatigata a colleague that. be wants to talk to him, but Lhe ' criminaJeandbadcriminalajuatliketbeteangood 6i18~t~ embezzlement, Joe'calla'a Louisiana eolleaguedoesaotwnntLOViaitiheiailiaperson.Fla ' cops end bad cops. They're human .beings, ou Private eye Lo report Chetbe b.a not yet been able ..has hired a lawyer who bas hired Joe to ¢o see what ~~.,.• Y to foes teeworkera'eomperwtioa claimant who hm 'the man in custody wanta:Joe will only tell me theta moved io Maine. Catching workers' comp frauds is a lot of people are worried about what the inmate Of.course not all oCJce'e work is laboring for the the bread and butter of moat private investiguLOra might be telling police.l-ie asks me Lo wait in the car - - damnad. Joe Thornton ie a good guy and as often as in Maine, and Jce does his share. Hin favorite case called ahead to let the aut.boritiee or the inmate - - not hegetetowearthewhitehaLSbedowingbimfor involved bwhwhacking through two and a hall ~ know be is coming. Cold calla are etandazd oper• . • day last week offered me acme insight torn the miles of swamp in camouRage gear carrying video sting procedure in mmihal defense work.' - variety and range of work thatcomeabisway: eyuipmentinorderLonailanemployeeofBathIron SiLiingiaibecarIcan'thelpthinkingaboutwhat,. The feat official bwineas Lhia particular day wen Works wbo was collecting diaebility checks fore seems to me to be the moral ambiguity of Joe's line -. e meeting with his partners in Hallmark Security ,bad beck. Jce. and a partner Tilmed Lhe man of work.I keep telling myself that under our aye tea lac, a recentepin-ofC from Lawyers Investigating operatingaekidderandacbainaawataloggiageite. of justice everyone is entitled to the best possible ' Service. Hallmark provides plaindothea protectio^ '-j'he guy doesn't get comp anymore." forcommercial residential, and construction siren. defense and Jce is jwt part of that defense Loam.. Just shout the onl Louse ti olive work Joe $ut here ia..lce, this eduutcd, iucttaaful,~ Inw. On.the nRrnda today ie a diseuesion of the Hoed tq Y g doesn't take on ie divorce work. Trying to catch abiding family man, ailing as a go-between for upgrade radio communicetiona at Orford Plains unfaithful spouses with their panto down doesn't aunpected •criminala. I have not .resolved Lhe di- Speedw~y,oneofHellmazk'amejoreccurilyelienta. appeal to him anyway, buLearl on he discovered lamas (clean mine,aot his before he returns NextJcepboaaaeman.vbo6mhiredhimiofmd Y Y ) out who 6ea been wa that divorce work wm uaIewaZdjng. Clients aren't from2he jail. sus pec4 a Iona it tchtrrg him ~d why'Tbe client hePPY ~ You don't catch tbetr spouses in Lhe act, "Good Wawa for my client,"Joe n rta. "He jwt p ary. Joe's inveatigetioa, which ~snd the aren'tha ao iruJudes running the license plate nu©bera oC enra. Y PPY ifyau do: wan4 fo tell him 'I can't hurt you.' ' . frequeatJy ipotted in the areaq and interviewin Alter lunch,Jce meets briefly with a local police For jwG anlaa4nt 1L ocxun Lome Lo aakJce wbo _ 'aeighbo_rs, auQgekL_ that Lhe m1n-is paranoid. Joe officer Lo discuss Lhe peeeibility ofsetting up yet a his client ii but then I remember Lboee tvorda - • politely Leda the man 6e h+~ "ao aror-active third company under Lhe Lawyers Inveatigeting ~ "You don't want io know... ~ .. .. - - Service umbralla- This company would offer Iou imapnatioa." This one u n free~ie, pro bona sad circa reveation by Fdgar Allen Beem P Programs. Joe nays he ua see PhotograPliY by Chnslopbar ~yrre - V COMMITTEE APPOINTMENTS , ~ . ~6 . LIBRARY ADVISORY BOARD . '. ` Number of Members: 12 . Term: three years - Qualifications: see page 3, Item B, 1-8 of Library Board by-laws. ` _ Regular Meetings: Third Tuesday each month at 3::00 P.M. at the°Library. ' " Statute or cause creating Board: Policy for the Governing and Operation of the Library. Brief on the functions: to develop necessary policies for the efficient and responsive operation °. , ~ of the County's -public library system. Also responsible for making recommendations to the County Manager and County Commissioners concerning the operating .and capital needs of the - '.library. ,Board members are expected to actively promote the library's service program; keep. abreast with trends in public library development and to work for the continued improvement of library services offered by the County. TERM ° PRESENTLY TERM . y - CURRENT. MEMBERS SERVING EXPIRES . Frank S. Conlon ~ Second 8-31-2000 . ' 1831 Hawthorne Road .:. _ _ `; Wilmington,. NC 28403 _ - (Appt. 8/22/94) . ° 343-8089 (H) (APPt. 8/18197) Jane I. Grant First 8-31-2000 . 111 Seapath Estates Wrightsville Beach, NC 28480 (Apps. 4/21/97) ~ - '256-2922(H } 392-76820 Nancy 'G. Millen . Unexpired 8-31-2000 20.18. Seawind Lane _ Wilmington, NC 28405. (Appt: 05/18/98) . 763-9988 (H} Mary K. Molly First 8-31-2000 ° . 4920 .Seabrook Court ~ ' Wilmington, N C 28403 (Appt. 8122/97) 799-3733(H) - Lethia S. Hankins ~ First 8-31-98 ~ ~ ° .307 S. Kerr Avenue _ Wilmington, NC 28403. (Appt. 8!21/95) 395-0074 (H) . .~ .. ~ - 67 LIBRARY. ADVI,SORY~ BOARD TERM ~ - : -; PRESENTLY TERM CURRENT MEMBERS SERVING ~ EXPIRES Alfred G. La ' ' ~ ~ • ° First 8-31-98 , 610-E3 L' idea Drive ~ d~,~~ df S I r~ ' ~ . ~ - - ;• Wilm' ton, NC 28412 .t-~~Pmi.h`~-m~tn-~-' .: (Appt.,:ll/20/95) 't. , . 3 -1314 ~ - ,. ~ _ _ Vivian-Sue Penn . - ~ ~ ' ,:. • `"Second' ~ ~., ° ~~ 8-31-98 :~ ~MacCumber Terrace _ 6719' Cable. Car Lane ~., • ~.:, ,~ ~ :," .~~r Wilmington, N_ C .28403 ~ :,, `~ ~ ~ (APPt• 4/21/92'] 256-4.848 (H) (Rea` t:' 8/2'1/95)'.._' - ' ~ . Ann W. Wilkinson Second 8-31-98' 2220 .S. Liye .Oak Parkway _. .. Wilmington, NC 28403 ~ ` ~~ a- 763-6883 (H) (Appt. 8/i9/91) ' (Reappt. 8/21/95) Fletcher C. Eddens ~ _. .. , F'r ~~~ _ . i st : 8=3'1 99 . . :1730 Fairway_.Dnve: <. ~ , ~ , Wilmington, NC 28403 - . '' ~: 762-0600 (H) (APPt• 9/19/96) C. Elizabeth Gaffney First 8-31-99 3723 Sand Trap Court ;-. - '~ ~ ' Wilmington, NC ,28412 (Appt. '8%19/96) 799-3762 (H) . ,.. Sane C. Gregory .. ., .. . ~ . •. ~ ~ - First : 8-31-99 ~~ 425 R. L. Honeycutt Drive - ~ - Wilmin ton NC 28412 ~' '' g ~ (Appt. 1/17/95 unexpired term) 452-4303 (H) (Reappt. 8I19/9b):, . Mary E. Hatcher - Unexpired 8-31-99.; . ~~ ~ ~ +- 1905 E. Lake Shore . ~ _ ' ' Wilmington, NC 28403 (Appt. 6!16/97) . 762-7259 (H) .. .. 6/98 ~ ~ . ~,. •, file: /lib ~ . ~: , ~,..~ ~ 8 ~'.wP NEW HANOVFR COUNTY ~ ~ ~ - - ' _ ~ BOARD OF COIt/1M/SS/ONERS . 320 Chestnut Stree~`, Room 305 Wilmington, NC 28401-4093 - ' Te%phone (9101 341-7149 . ~ ~ FAX (9 1 01 34 1-4 130 ~ , -- .App/ication for Appointment to Boards, Committees, and Commissions Appointed by the New Hanover County Board of Commissioners. equE ,'hatrie .,`tome ~ Gs ow long have. you been a , . 4ddiess•-.~~? pc~, ,~~~ ~~d /~sident ofNew Hanover County? ~rlailinga ddress. D ~ - ~ ' City and Stafe: ~ Zip. Code: ~ ~,~ ~~ - ~ . Telephone: Home: ,r9/d~ ~~ ~ -- ~ (~ ~~ Business: / y , 'Sex: E'/7k~ "Race: "Age: ~ ' 'This infor 'on is r quest for he sa/s purpose of assuring Thal a cr ss- ection of the cam unit is ~ ~ "~ /oyedby _ y pointed. A person cu Wily emp/o yed b y the ag ncy or de artment for which this application i ade, must resign his/h r osition wi New Hano th ; ver County upon appointme in actor ante with Art~ic/e V/l, S 4 of the ew Hanover County Per onne/ Policy. JobTi tle: ~'rofessionalActivities: -~' . ~{J _,.`~~~ ~olcinteer;4ctivities: ~ ~'"~ ~.t--~-~~ _ . Nhy do you wish to serve on the Board, Committee, or Commission requested? - r r / n ., `r ,rt~ih~ .lam' /~/),Qi1~f~/A~/ n Nhat do you feel are your qualifications for serving on the Board, Comm ttee, of Commission requested? ~cJ / Nhat areas of concern wou/d you like to see the Board, Committee, or Commission address? J , lre you currently-serving on another board or committee a i . ~~ ppointed by a municipa/it y or a ounty? if so, please -list: ~'~ ~ ~ i ,~ ~. 'ate: t ~ . '/ease use reve side foc_addi ns/ comme sJ nYi~~,l .~ r Stgnatur ,$D. G C ~ . ~' NF"W HANOV,ER COUNTY BDARD OF COMMISS/ONERS - - - ~ - - 320. Chestnut Street, Room 305 Vt/ilmin _ - - gton, NC 28401 4093. • - ~ Telephone (9101 341-7149 FAX (9101 341-4130 - App/ication for Appointment to Boards, Committees, and Commissions' Appointed by the New Hanover County Board of Commissioners. - Request for Appointment to: .. ~ •- .Name: ~OBEr~/~ L• /%i4 y0 Home-, ~ ~• - !Cl/!1~'~G_TL' How long have you been e Addiess.~ 308 ///1~BF~, ~~,e ~,t/ ~t~DS resident of New Hanover Countyl 3f •~~~s 'Mailing Address: ~ 6~D S / /L~BFTL ~~EE/~ ~,t/ ' City and State: Gf//L.,/~~j~/f~T~/1~ ~ ~~ Zip Code: ~8 ~OS~ Te%phone: Home: ~/Q - ~ ~l -- 7 ~ 7 ~i Business: 'Sex.• - ' ~ •Rece: ~ -Ape: ~ S 'This inlormetion is requested lar the so% purpose o1 assuring that across-section of the community is appointed. ""Employed bY: ET/hEl~ , ~~il EST//!/6 GU ~ - ' ~A person current/y employed b y the agency or department for which This app/rcetion is made, must resign his/her position with - rNewHenover.Counry upon eppaintmenh, in accordance with Aitic/e .Vl, Sec. 4 o/the NewHenover County PersonnaJPolicy Job Tit/e: - , ~~.QJE.vG'C y// ~vs: ~3s ~l rt!ll6c= it9c 7- .Professional Activities: ~cGRF~ j'_.i/6/ii/EE,t~/.tl~ /G/,¢R/{ET,~J ~j/~~} TF_GI C ~ J -9NN/ill /3v~GET~- ~/~~~. Ftc//-// 1~ii~~i~~ i !/~ .C ~ S!/ L_'~11; -i/,T'TE~ VolunteerActivities: - P S%~~1UT ~7l~'J9Fli!•I~i1l.~S /~.SSG~. W_ b y do you wish to serve on the Board, Committee, or Commission requested? ~ ~ST~~,~~ ~S~.~E ' Ta 56c /r~E" ~y~Tys ,E~UL.4TiO~lflL ~ ~UL-TUf7,4C~ FiS~/Lr77E.5' /.~1f~'Dt~E' y4S T.f~~' . .What do •you.,feel are your qualifications for serving on the Board, Committee, 'or Commission requested? L7`/Y~ ' .What areas of coricerri would you like to see the Board, Committee, or Comm/ssion address? ~l~ ~E- `/~j,(~,ct,~ ST~/~-( G' rte SoS~_S _" ` ~/ /17 .t~0~'li1/l y ~E ,E.~G,4 T/cr/ D~' ~~fE ~ O!/~s/ f~D~iJL,q~~r,~ •Are you current/y serving on another board of committee a ppointed by a municipality or /a county? Nso, please-list: • r/~ /~i,/CG ~Q~"i'/i TTE~ . ~~:~ /V~~T~~ST n'G~ .GiB,~~,r2 • ~ /B .~ ~ ~~!, v i=,i_J , Signature ~2'~~ti (P/ease. use r verse side for additional comments) . '' ; l 9 1998 (ovEx> .. , ... ,.~ r+o ~: ' . - -NEW HA NO V.~R COUNTY . . .: ~ ~ BOARD OF COMM/SSIDNERS • ~ 320 Chestnut Street, Room 305 ~ . Wilmington, NC 2840.1-4093 • - ' aTelephone (9.1 01 34 1-7 149 , FAX (9 101 34 1-4 130 • Application for Appointment to Boards, Committees, and Commissions Appointed b y the Ne w Hano ver Count y Board of Commissioners. Request for Appointment to: Ll-~/ ~~~fv~//~ Name: ~ . `1./-F Nome / ~ ~ ~~ ~ .~~ How long have you been a • Address:~t7(~S ~ iY.~'!?-e~f ~~- resident of New Hanover County? .~ "Mailing Ado'cess: (iU .. City and State: ~ / V~V L~w~L[/J'L4LJ Zip Code: ~ ~ - Te%phone: -. Home: ~/~ ~ 3 ` Ff ~~ ~ Business: _C /~ ~ --~ ~,,,, ~ (~ G~ I ~ 'Sex: ~~~i~[ ~~ '-Race: - . .Age: ?- / 'This in/wmetiom is requested far the sole purpose of assuring the(ecross-section of the co mu it is a /~ ~ Y PPointed r~ ~~ 'Employed by: ~? l ~'-QJ ~f~~t-~-Y~ ~~_ ~~,~ _ `~~~~ - ~~S ~~~X'-"`_ . . 'A person current/y emplo yed b y the agency or departmen t for which this application is made, mus(resign his/her position wit ~ J ~j/ New Nenover County upon appointment, in accordance wit/ Artic% V/, Sec 4 of the New Heriover County Personnel fb/icy Job Title: ° , , i YG~i~-~'-~Z~ ( _. . ~ _ l _ . ;Professiona/..Activities: ~/~~iYl~-~'/ ~UPi~ ~ . ~L~} ~-ISOGC C C1 ~ I~'~~ C' VolunteerActivities: ~1/L'~ ~ ~ ~ m C~~~~e ~NC{~~ SL S 'X RUC, v~.~D q.~--r~s~ 19 7 y ~~ ~ ~- ~~ . .. Why ~o you wish to sere on the Board, Committee or Commis requested? ~- ~ . } ~, ~" . a~ ,~ ~ f 1 S What do you fee/ are you ua/ifications for ser~in on the B ard, ..Committee or~Comm sst n re ues~S d ~, , 'lt~Ce,,~ --~2lNLC.Q~ ~ ~ Wa-J ~ .~~ ~ CVV~1. Cc~ ~1, ,~ '°~`~' . - ~~r~~, What areas of concern wou/d you ike to see t e Board, Committee, or Commission address? L -~-«C ,ire you currently serving on another board or committ ~~ y ~L"n-0 - , ~. ppointed fby a municipality count //so,'p/ease list: O • -~ r / l D ~ ~O ~~r l Signature ~ - (~ (Ploese use re rse side'/or additional commentsJ. - '~l~ ' 2 S 1998 (OVER) NEW HANOVER REGIONAL MEDICAL CENTER rOARD OF TRUSTEES (~ . - ~ ~.J Number of Members: 15 - (3 ex-officio members: County C~~mmissioner, Chief of Medical Staff and the Past Chief of Staff) Terms: five years -Not eligible for reappointment until one y;ar after term unless originally appointed to fill an unexpired term. Effective September 199:1, new terms are for three ,ears Regular Meetings: Fourth Tuesday, each month at 5:00 p.m a.t the Hospital. Committees' of the Board average one meeting per month each. Trustees serve on two or three committees. Statute or cause creating Board: Charter or Articles of Inco~puration issued by the Secretary of State, dated May 26, 1967. Brief on Functions: Takes responsibility for the operation cif a large public hospital through the establishment of policy. and the deciding of major questions on finance, scope of services, facilities, future directions, etc. ,'and through evaluating quality and costs. CURRENT MEMBERS Charles M. Coleman,, Jr. ~2112~ Ascott Place Wilmington, NC 28403 763-2075 (H) 799-4877 (VV) Corneille Sineath 6664 Cable Car Lane Wilmington, NC 28403 256-2719 Henry M. von Oesen 412 W. Renovah Circle Wilmington, NC 28403 762-8313 (H) Margaret Weller-Stargell 813 Tarpon Drive Wilmington, NC 28409 452-1887 (H) 343-0145 (W) David B. Benford 1645 Country Club Road . Wilmington, NC 28403 2 46 (VV) 452-9961 (H) ~~. .TERM PRESENTLY - = TERM SERVII\'G ..EXPIRES Second 9 30-99 - ~ ,. Appt: 9/20/93 ~ . Reappt, 9/16/9.6 ~ •' Second 9-30-99 Appt. 9!20/93 Reappt. 9/16/96 =:,Second ~ 9-30-99, ~, First Second Appt. 10/4/93 Reappt. 9/ 16/96 9-30-99 Appt. 11 /18/96 9-30-2000 Appt. 9/19/94 °~ NEW HANOVER REGIONAL MEDICAL CENTER BOARD- OF ~ TRUSTEES (CONTINUED) TERM PRESENTLY TERM ' CI:fFZRENT MEMBERS SERVING EXPIRES Lather Brown ~ Second 9-30-2000 1944 Brookhaven Road . Wilmington, NC 28403 Appt. 9/19/94 ' . 762-7883. (~ 343-1991 (F~ Daniel E. Dawson ~ Second 9-30-2000 . 3177 Wrightsville Avenue Wilmington, NC 28403 Appt. 9/19/94 - 762-0766(H) 762-4200(VV) Charles Cecil Wells First 9-30-2000. ~ " 2211 Marlwood Drive ' _ -Wilmington, NC 28403 , . flppt. 9/19!94 . 452-7195(H) 763-9976(W) ~ _ Pamela S. Morine ~ _ First 9-30 98 ~: .-: - 101 Windlass Drive _ :; Wilmington, NC 28409 (Appt. 9/18/95) 452-1770(I~ 799-7800(W) Sylvia H: Rountree First 9-30-98 Wilmington, NC 28403 Gc/i~,~r ~,~.. (Appt. 5/17/93 to unexpired 5-year term) . 76 - (H) 2 S~ -_ ~,c 3 / ~„ Z ~6 ~c6D (Reappt. 9/ 18/95 to 3-year term) William C. Taylor First 9-30-98 12$ Partridge ;Road , `Wilmington, NC 28412 (Apps. 9/18/95) ~~ :791-1432(H) F. Spruill Thompson Unexpired .: 9 30-98 - , P.O. Box 5 Wrightsville Beach, NC 28480 (Appt. "5/18/98) ' . 313-0737 0.256-6999(W) ~ Ex-Officio Members: ,.Chief of Medical Staff and Immediate Past Chief of Staff - Buzz Birzenieks -County C William K. Atkinson, President, NHRMC, ommissioner ' P.O. Box 9400, Wilmington, NC 28402-9000 343-7004 ~ 5/98 File: T~7[~I NEW NANO VF'R COUNTY BOARD OF COMM/SS/ONERS _ . 320 Chestnut Street, •Room 305 ~ ~. ~ ~ 1f,~/1~ Wilmington, NC 28401-4093 "S P -_ ~~ 19'3 Telephone (9101 341-7149 199~~ . , , FAX (9 101 34 1-4 130 .:. ,. ~ _'~'~';; l '.. App/ication for Appointment to Boards, Committees, and Commissions • Appointed b y the New Hanover County Board of Commissioners. v Request for Appointment to: New Hanover Regional Medical Center Board of Trusfees , Name: Paul B. Hubbard A Home How long have you been a Address: 818 .Cutter Court , Kure Beach resident of New Hanover Coun'tyl '3_ years + Mailing Address: 818 Cutter Court ~ ~., t ~ , .~. . City and State: Kure Beach, NC Telephone: Home:- ,(910) 458-9256 Zip Code: 28449 Business: (910) 392-3313 'Sex: Male 'Race: .White 'Age: 41 ' 'This inrormetion is requested for the sa/e purpose of assuring that across-section o/ the commuriily is;eppointed. ,` "Emp/oyed by: Medical Trans ortation~ S ecialists, Ina. "A person current/y amp/oyed b y the agency or department for which this app/ication is made, must resign'his/herposi/ion with ~~ New Henover.Counry upon appointment, in accordance wish Artic/e V/, Sec. 4 of the New Hanover County Persbrine/PoGcy. Job Title: President/CEO - ~ ~" '_ Professiona/Activities: member American Ambulance Association, NC Assoc. of EMS Administr< VolunteerActivities: tors Why do you wish to serve on the Board, Committee, or Commission requested? I can provide valuable, insight and knowlege concerning the delivery of pre-hospital emergent and non-emergent care. This is especially relevant now that the hospital is responsible for the EMS system.,. , ,. What do you fee/ are your qualifications for serving on the Board, Committee, or Commission reques'tedh -I have been a workin artici ant in the re ion's EMS s stem since 1994 and have an .understanding of the needs and. responsibilities of a comprehensive emergency care system. What areas of concern woti/d you like to see the Board, Committee, or Commission address? I want to ensure that the needs of th`e citizens of New Hanover Count continue to be met in a~'responsible and affordable manner -- insuring access to all segments of our society. Are you currently serving on another board or committee appointed b.y a municipality or a county? if so; please list: _ n/a ~ -• - Date: L 5'g .. . `,: ~ ~ ~. (P/aese use rev rs id for eddi~ione/ oomments/ Signature _ (OVER) r~", NEW HANOVER COUNTY BOARD OF COMMISS/ONERS ~ ~ ~~' 320 Chestnut Street, Room 305 Wilmington, NC 28401=4093, . _ . Te/ephone (91 D) 341-7149 .A ~ ~ ~ ~ ~ ~ 1 FAX (9 101 34 1-4 130 Application far Appointment to Boards, Committees, and Commissions Appointed by the.Ne.w Hanover County.Board of Commissioners. Request >rorAppointment to: Board of -New Hanover Regional Medical Center (NHRMC) Name: Pamela S. Morine ~ ,: Home ~ ~ - ~ ~ - How long have you been a Address: 1'01 Windlass Drive resident of New Hanover County? 4 years Mai/ing Address: 101 Windlass Drive City and State: Wilmington; NC Telephone: Home: (910) 452-1770 Zip Code: 28409-2030 Business: (910) 799-7800 "Sex: Female «Race: White »Age: 41 ' 'This in~armation is requested for the so% purpose of assuring that across-section of the community is appointed. ""Emp/oyed by: Morine Financial Services 'A person currently emplo yed b y the agency or department ror which this application is made, must resign his/her position with New Hanover County upon appointment, in accordance with Artic/e V/, Sec. 4 of the New Hanover Count Persannst Polic ,.. .. Y Y•. Job Title: President Certified Public Accountant since 1977; Certified Financial Planner (CFP Professions/Activities: s;n~e 1986 MBA -Wharton School•A B cum laude in Accounting Duke U (OvE Treasurer Riverfest, 1993-Present; Board of Directors, Lower Cape Fear Vo/unteerActivittes: Memorial Society and Friends of Public Library Why do you wish to serve on the Board, Committee, or Commission requested? Seasoned, experienced de NHRMC in a balanced manner in its transition to a highl nized re tonal rovider of ualit healthcare. I believe I offer the ex erience and talent which the Board seeks. What do you feel are your qua/ifications for serving on the Board,,, Committee, or Commission requested? 3 years of hospital and healthcare industry auditing as a CPA with the Big 6 accounting firm of Coopers Lybrand coupled with m 20 years of Fortune 500 and ersonal C.E.O. ex erience in mana in budgets in excess_of $SO million. ` What areas of concern wou/d you /ike to see the Board, Committee, or Commission address? Successful mi ration of hospital olicies towards increasin trend of mana ed care• favorable community resolution of dual hospital operations. ' Are you currently serving on another board or committee appointed by a.municipality or a county? /f so, p/ease list: Date: _~i~ember 5, 1995 (Please u~~rse side for additions/ corrimentsJ ,:~ ,,i. ` r-~ Signature " ..~.. . Parriela S . Morin ` 101:windlass Drive wilniinjton, North c~~ Zs4o9-2030 ':. HOME TEL: (910) 452-1770 OFFICE TEL: (910) 799-7800 FAXr .(910) X52-7565 :, EDLTCATION . . . .. .1975 A.B. cu»i Iaude, DUKE LTNTVERSTTY, Durham, North Carolina. Major -Accounting .. .. .; 1980 M.B.A. witla distinction, WHARTON SCHOOL,. UNIVERSITY OE PENNSYLVANLe,, Philadelphia, Pennsylvania. Major in Finance, Strategic Planning and Marketing. ' . ` EXPERIENCE , . .1985 -Present PRESIDENT, MORINE FINANCIAL, SERVICES; Princeton; New Jersey (1985-1991) and Wilmington, North Carolina. Head of a growing nationwide financial' planning ., services practice. .Oversees in excess of $20 million in assets belonging.to more .than 350 individual and corporate clients, Areas of expertise include retirement and estate planning, employee, beenfits, , educational funding, tax strategies and. asset preservation and growth. 1981 '- 1.985. AT&T INTERNATIONAL, Basking Ridge, New Jersey. t 1983-1985,DIRECTOR.OF Z~tAIN1NG.;`Exceeded revenue objectives by 70%~by selling ... AT&T training and consulting services.as a product outside the United States. 1981-1983 ASSISTANT DIRECTOR OF BUDGET. Designed and implemented budgeting . p"rocess for AT&T's new international subsidiary. Developed the company's first international buthet control procedures and corporate instructions. Success led to nomination to AT&T's Advanced Management Potential and Assessment (AMPA} Center. Attained highest recorded score in'Center's history 1980,- 1981 SR. INTERNAL CONSULTANT, REVLON; Edison, New Iersey: Performed numerous studies oncost controls in cosmetics and personal care products.: . . ~. 1974 -.1980 COOPERS & LYBRAND, ~ , . ; ° . ., , 1977 _ 1980 SR. MANAGE1~iENT CONSULTANT, New York City_ Headed and .participated in enQa~ements on behalf of clients. Specialized in finance. and accounting applications. . 197.4; - 1977 C.P.A., AUDIT DEPT, Newark, New Jersey. Performed audits of banks, ` educational'. institutions, hospitals, manufacturers and non-profit organizations. •- -CONTINUED - Resume of Pamela S. I~'Iozine ~~..~ . , ., Pagc ? of 3 .. t ~ ----. ~~ ` Certified Public Accountant since 1977 -Licensed in North Carolina, and maintaining inactive sta in New Jersey. tus Certified Financial Planner since 1986 Registered Investment Adviser since 1988- Registered in North Carolina and New Jersey ' Certified Managment Accountant 1981 - 1985 r Securities. Licenses.:.Series' 7? -. General Securities Representative _ Series 24 -:.Registered Principal ~`` Series 63 -Uniform Securities Agent ., Insurance Licenses: Life, Accident & Health in North Carolina, New Jersey and Kentucky PROFESSIONAL MEMBERSHIPS ", , ~ ~ • - ' Member =American Institute of Certified Public Acceountants (AICPA), Internation ! Certified Financal,Pl.anners;(IBCFP) -._. - ~ ~ Board of CREATIVE WORKS ._ i -:. _~ -e . Host/Producer of ,"Weakh Marter$'; weekday fuancial la ' ~ o . ~ ,i :, p nrun~ radio. rogram P , ; WMFD,=AM ~ - (1992-Present) and WBMS-AM (1994-Presznt), Wilmington, North Carolina. Currently in . discussions to be syndicated. ~ ~ s Guest Host of "Financially Speaking ", weekly call-in radio pro~r-aai on personal .financial. WH~~-AM, Princeton, New Jersey (1986-1991)' Pl~~g,. Author~of many artcIes,on financial planning. • - AWARDS AND HONORS ~ • , . GREEN EYESHADE AWARD, Atlanta Society of Professional Journalists, 1994, naming "W Marrer.~" radio program as a Finalist for Best Business`Reporting in 11, southeastern states eahh WHO'S WHO IN FINAItiTCE AND INDUSTRY, 29th Edition listing ~, ;1994: -... NORTH CAROLINA DISTINGUISHED WOMAN'S AWARD; Noi-tl-i Carolina Council For Women, 1994, Finalist in Business/Professions category. CAPE;FEAR WOMEN O,F AC~HIEVEMEI.IT, Wilmington, North Carolina YWCA,.1994 winner in -the "Professions"~ category. TRIBUTE TO WOMEN IN INDUSTRY (TWIN) AWARD, Princeton, New Jerse YWC for accomplishments 'in business. y A, 1986 YOUNG CAREER WO1vIAN FOR NEW JERSEY, Business & Professional Women's Association, 1978. ` - CONTINUED - ~J 82 AUG-11-9d 1JE 10:26 P. 02 ' NSW HANOViER COUNTY BDARD OF COM/VIlSSl0l1l~ERS r ~ ~ ' ~ ' 320 Chestnut Street, Room 305 . WI/mingFon, Ne 28401-4033 ~;~; 1 3 1998 ' - ~Te/ephone (910/ 341-7T49~ , ~~• F•v•:. „ 1, fA~' 19101341-d 130 ~~ ~ ~.•~ ' _' Application for Appointment to Boards,-Committees, and Commtsstons APPoinfed b y the New Hanover Covnty Board, of Commissioners. Request lorAppointment'!a: ~ - ' ` ` ~ ±- ~ 1 Name: -2 y~ v~ ~ , i (. k,5 Nome ,' ... -,- ' Address; _ s~ ~ ~~,a ~R ~~, How /ong have you been a residenCofNewHanoverCountyJ . ~ ~~ Mailing Address:. ~ 3 O ~ `C ~ ,1 ;~~'.~s. r{ .. `. - _ . . Clty 8nd State: ,~ ; ~ fiYt , n~--~~ ~ p o2 ~ ~~ _ Z' Code: Q/ Te/ephone: fi'ame: / O - aZ - 7 ~ 7 `' 'Sex: .Race: _ ~~ GJ~`6 "This i4-rtormiUon is regtrssted t'ar the eo/s purpose oT assrva~y th~~ ~~_rocliOn O/ ~a ~,~~~~ tY~s eppoinled. "Empla yed b y: ~ 7, ' 'A person ctir'/e4dy ernp/oyed b ' e e G ~ . C~~~ , New Nenovor Count v on a Y pencyordepsrtrnenf far w{xch this p/Jcetian IsubeOe, mus{resign Ars/Ti0/p0.tifion witfi Y P pFOtntmenl in «'cott>inee w1lhArtdi Vl, Sec, 4 ot'the NswNenoverCounty Pottannel hbtPry, ~/. /ob Tide: 4 ~ .. G _. Proles sr"orta/Activities~~<< / ~ c~~~ ~ ~~~~ ~~ Ate, S~c.L ~ ~~ ~, 9~q L..~~~ ~~-~ Vo/unteerAct/vlties: ~ ~~, ~ /~~~, ~ L Wh y do you wish to serve on the Board, Comntittev, or Commission /er?uested~ ~o (dyl, /,~ / _ _ Y• '~t 7n . n ~~~n ~~ `S ~ ' F..~.L ~j k iC ~-- ~, ~ Whal do you fee/ are your qualifications for serving on the Board, Committee, or Commission repuesteOT ,Pu;~ 6~~~ [ -~----- V - iJ /.- /Xi c ~- C~ E. J r ~ y -~-~ ~ /JifZ C"c ca / ~ ib ~ ~,~rv What areas of concern wou/d you like to see the Board, / Committee, or Commission addressT p ~ Are you currently serving on another b,/oa~rd or committee appot'nted by a muniapa/ity or a county /f sD, please list: /`~~ Date: I Z /~ lf7oese aso reverso side /or eddt/one/ rn S~pnaf[f1'B mrr7enu) (OVER) 84 - ,. ~ ~' NEW HANOVER COUNTY ~ -~~_`~~`~)y.'~ BOARD OF COMNI/SSIONERS SEP p 1 ~; f? 320 Chestnut Street, Room 305 /~ ' t t .'."r;v CO. Wilmington, -IVC .28401-4093 ~ '"° ~'"`" Telephone (9101 341-7149 '-FAX (9 101 34 1-4 130 App/ication for Appointment to Boards, Committees, `and Commissions Appointed by the New Hanover County Board of Commissioners. .. _ .. _ .. Request for Appointment to: yew ~-9/~/ov~R ~~~~ONf~(. M~bfcqu.GrN>cs2 ~4~2~D,-~.c= Tiec~s7~S ,:. ._ Name: 3oSE(~~-1. 12Et.TgG~}TT _ _ _ - . Home Address: 3 g3`( t!~<MS roe/ /3Gu0 . Mai/ing Address: City and State: _>..t/(c,1-r/! KG Tn^/ ~ N C Telephune: Home: l~I/v) 7~~-a~76. Zip Code: Z S Y o 3 Business: "Sex: j"~ "Race: ~/ "Age: ~ ~ f 0 'This information is requested for the sole purpose of assuring that across-section of the community is eppoinfed. •"Emp/oyedby: IQC~iIREf~_ ~ _ "A person current/y amp/o yed b y the agency or department fat which this app/icstioh is made, must resign his/her position with. New Hanover County upon appointment, in accordance with Artic/e Vl, Sec. 4 of the New Hanover County Personnel Po/icy. Job Title: Professiona/Activities: _~'~G/NECi2/Ns CoN.~'crLT,Q.H-7 Pa57cNAIRlY9N cowE2 ~-~PLr FEA2 tvA7t~K w~'2 ~`{Tl•{[9Kt <Y VolunteerActivities: P~-S7 L/~)g1~QKp}-N W)t,f{/~GTmN 8dA-R-n or' pp3-4z; ~g~ SE v2 NAT COi`LP4-7~~YZ /I~LST 4i-7de2 t~7 St=NIDrt CC,N7'~~ Why do you wish to serve on the Board, Committee, or Commission requested? /y memE -ro x"7'4 ~~/ f3Ey~' ~~ Ts RC ~ ~, ~~-d r- e ~ K ~ ~%f ,uos P. ra. z What do you feel are youi qualifications for serving on, the Board, Committee, or Commission requested? ~EbPL~ SK/t1S 6AIN~t~ D4>'2)N~ Y1y fKo1=~S/DHA~- C~KS ~S alQ~c.Ta~ ct' ~N6/~(d~2/isl6 What areas of concern would you like to see the Board, Committee, or Commission address? ~fiPLOyEC MuRRLL ~ ~-}t`ALTI~. 56'Q!//GL~'S 7'a T.S1E /¢.~~A J ~K1 Dt' GIQOt~'T/~- Are you currently serving on another board or committee appointed by a municipality or a county? if so, p/ease list: uo GCC~C~OC~~® SEP 0 2 1997 Date: ~~ tP/ease use reverse side for edditiona/ comments) r'~ ly Hp,"~0~'ER CO. ,,. ~~ r~ ' ''~~;C' .RS ~~Z 9~~~ ~- ~^~~~~ Signature How long have you been a resident of New Hanover County? 3 tJ yIQS NEW HANOVER COUNTY ' BOARD OF -COMMISSIONERS ~ ~ ` ~ - 320 Chestnut Street, Room 305 .. ~ Wilmington, NC 28401-4093 - ~ Telephone (919)`341-.7149 FAX (919) 341-413,0 - .- Application for Appointment to Boards, Committees, .and Commissions ..,Appointed by the New Hanover County Board of Commissioners: Request for Appointment to: /L' ~/ I ~ ~ ~>~/~,Q ~~ - . Name: ~d/~ ~ Olly~~~~ - Home D X Address. How long have you been a resident of New Hanover County? ~~ ,Q,f MailirigAddress: E City arrd State: - - _ Zp Code: ~~~~ Telephone: Home: / ~-2 - ~-ZS1J .. Business: "'This information is requested for the sole purpose of assuring chat a uos~section of the commun is a ~Y ppornted. Employed by. - .. "'A person currently employed by the agency or department for which Phis application is made, must resign his/her position with New ~HanoVer Counfy upon appointmerit, in accordance with Ariida Vl, Sec. 4 of the New Hanover. County Personnel Policy. Jobe Title: ~ . - ,ProfessionalActivities: Vff~~~~unteer Activities: /y ~' i~~ X, C_ / ~ZC-~J~:S' i~~ ,~ . ~ ,~ . Nhy do you wish to serve on the Board, .Committee, or Commission requested?~ .Qjfj . r~,~~4; Wha o you feel are your'qualifications for serving on the Board, Committee, or Commission requested? ~-~~- . - • Wh-at areas of concern would you like t see the Board, Committee, or Commission address? - (Please use ieverse side for eddiYional comments) ,- , _.~ . Date: °-~~.~ , /~5~~ ~ - 0 3 93 ~ . - .. r.r, ~ Signature -:..,. , ~ --~ ' ~.;.~ .NEW HAND VFR.: CO UNT Y B DA RD OF COMM/SS/D/VERS 320 Chestnut. Street, Room 305 .- ' ~Wilm,ington, /VG - 2840'1-4093 Telephone .(910) 341-7149 ' ~ FAX (91.0)3.4.1-4130 ~ ~ .. App/ication for Appointment, to .Boards, Committees, and Commissions " '. Appointed b y the Ne w ~Hano ver County Board of Commissioners. Request for Appointment to: • / Y ~ i-./ ~J~4-/v e t/~2 f~C G ~o c~{~3 C.._ . ~ ~ ~G~ ~ CE~c 2 .--- ~ ~ Name: ~~ S C P !-~ 1-. :.S p -r ~ _ :: . , ,. . _ _. - -- .. Home .... ~~~~ ~~~ ~~a~ - How'long have you been;a ~ ` ' Address: -• '~- ~ resident of New Hanover County?`-Z~ ~~ _ ~.. .Mai/ing Address: ~~ !~,a ~ ~~.`7" ~y _. .. . - _ ~ : _ _ ., .- - - -. ; ,. . - ,, r ". _ , , . City and State: V v ~t L.-N-+: ~~ j J ~ /f ~ _ .~ :., /_- • Zip Code: 8 . ~ ,o b ,- / .._.Telephone.• Home.• ~_9 / o ~. -Y.1 ~ ~ L~ ~ 3 ~ ~ -- .S~s~ss~_~~/o)' j'.(~(,` ~ Ys~L,~ "Sex: ~ ~} ~. ~- ~'"~ ~ .. "Race: C' ~' c-L. - »Ape: .~ . - 'This--information"is requested for the sa/e purpose of assuring that across-secLon~of fha, community is eppoinled. ' - - ''.4 person currently employed by the agency or department for whrch thrs app/rcaUOn rs made, must resrgn'his/herpostioo with ' New Hanover Count u on a ..... Y P ppornlment, rn accordance wrth Artic/e V/, .Sec.- 4 of the New Hanover,"County, Personnel Policy. ~~ .. _. ~ r ,,. -, _.. -..-._ ,~, m ~ Y -. .; ~ .. Job Title: " Q ~~ ~ 1~~.:~ ~ ~ ,. •- ~: ~~/S2lC~ G'aC~~~~ f~ _ Professiona/Activities. ^~~~~ ~'~~-~~CyT:c/6~,J' __ - ~ ' • .._- - ~ _ _ ~• _ VolunteerActivities: ~ !7 ~J1' /~d~~ ~it//7~~G~'sh~ - ~'1//G.~,~:v'~i~/ : ',~cC.~~/~~ ~ Why do you wish to serve .on the Board, Committee, or Commission requested?• - ,, ~ , `S'am C ~- ~ _ ~ ~.~ ~~~~-2 - : - -...' ; ; _ . " _ _. _ .. .. , ' .. :. _. What do you feel are your qualificarions for serving on the-Board, Committee, or Corrimt'ssion requested? Sic .~~~~--~c,~ ~ ~ -.L~~T~ ~ . ... _. What areas ,of concern would ;you (ike to see .the Board, .Committee, or Comm/ssio'ri address?' • + Are you current/y s''erving on another board or_committee a ' - ~ - --•~ ppotnted by a muntctpality or a county? /f so, please lt'st:, ,-•~ Date: `~~.~T - /'3, / ~~~- ~ ,. f;UG )) 1998 signatu eL ~' • ~ ~, ~ . (P/ease use reverse side for additions/ coiiimentsl _ . - .. _ r JOSEPH L (JOE) SOTO 660 i Sedgewood Road (91.0) 2 5 6- 6 6 3.1 Wilmington, N.C. 28403 (910)256-4696fax ' EmailC~: JOS4GO~aol,com CAREER SUMMARY and OBJECTIVE: Seasoned health care and marketing professional. Career goal is to secure a administrative management or consulting position with a major health care related firm that values the importance of building long term client relationships. Career, traits include self motivation,. a "can do" attitude and solid communications skills. CAREER ACCOMPLISHMENTS .MANAGEMENT: Recruited and developed an effective management team of nurses, medical _ ~ staff and ancillary department heads over 20 years- in a growth oriented community. acute care hospital Developed a personnel department with revised policies and- procedures to implement a strong total quality management program praised by JCAHO in1995.~ -FINANCE: Using ~my CPA background, implemented a computerized departmental ' performance ~ reporting system that increased billing units of service. from $3 million to . $70 million and cut lost charges by 18% per year. All key department heads were on a performance based evaluation and merit system based on their budget and operating ~ ' statistics annual performance. _.. ._ _ MARKEl"ING: Planned and implemented regional co-op advertising campaigns for . women's services to include TV, radio and print materials. Created special promotional _ campaigns. for .occupational and rehabilitation services with two physicians and seven 'licensed physical therapists directed towards business and .industry.. Programs exceeded projections in both examples by more than 10%. ~ , ^ INFORMATION SYSTEMS: Selected and implemented automated medical record clinical . . based. information, system to include nursing hand held point of service patient care units. ,Systems deployment overt2 months included direct contact to physician's office and. home if desired. Six months after installation nurse's survey exceeded 90% satisfaction. Physician's offices were signing for earlier start dates and training times. for their office staff than originally planned. - WORK EXPERIENCE Cape Fear, Memorial .Hospital, .Wilmington, NC;142 licensed acute care beds, JCAHO - accredited; Formerly a nonprofit community hospital system with 600+ employees. ' Successful downsizing of 18% of employees in 1995. Sold to Columbia/HCA in ' ApriIY996. Held senior management positions working with an all volunteer board of trustees .and 200 .plus medical staff. Responsibility increased over a 16 year growth and development period to include six new multi-million dollar construction projects and .many smaller renovations projects. Programs started included occupational ~° therapy, .university health clinic, geriatric health clinic and invasive neuro-radiology ,,center (7/75-11/95). 89 JOSEPH L (JOE) SOTO WORK. EXPERIENCE cont. • -.page 2 ,. _ Lowrimore Warrick & Co., Wilmington, N.C. Started as Senior Staff Accountant. working on small businessclierits audits and tax returns. (7/73-7/75). .~ Price Waterhouse. & Co.,P-ittsburgh, Pa. Advariced from staff accountant~to senior . , accountant and from the general audit staff to small business staff. Ranked in the top 5% of~ class after four years experience.(?/69-7/73) `' US Army Adjutant Generals Corp-Ft Sill OK, Personnel Officer, Maj ret. (7/67-7/69) EDUCATION 4 ,. - ._~, ~_ ~ ~ . ; : . MPH degree in Health ,Policy and~Administration, University of ~North~Carolina-Chapel.. •. Hill, May 1988; ,Executive :Program-certificate,. UNC-Chi, Jan 1984; Center for Creative Leadership-certificate, Greensboro,N.C.,Sep 1990; Washington University Forum-certificate, 1994; BBA degree-Accounting and Economics, Marshall University- Huntington, WV,May 1967; CPA certificate #8803-N:C: 1975, inactive1983. -Many ~, continuing education, seminars inTrustee education; physician leadership development, , HMO,and manage care implementation; and JCAHO.accreditation byrAmerican College of . Health,. Care. Executive-Diplomat •1993. ~ ~ ~~ ' .~ .. , ., . ORGANIZATIONS North Carolina ~ Hospital Association Board Member `1993-95; Coastal Carolina Health Care Coalition. charter member.and treasur"er 1992-95; Red Cross Board member. . 1990-96; NHCo- NC Project 2000-chairman 1992; NC Hospital Association-,Project .. 2000 committee member 1990; Hospital Hospitality House board member; Hospice board member; Centura Bank advisory board 1980, past chairman 1990; Wilmington Executive Cl,ub~,, vice president-1995; Wiirriirigfon Rotary Club member 1.9,85 , Wilmington Excellence. member 1992; United ~ Way planning committee 1.988, American _ Institute of,C.PA's .1975=83;~ Cape. Fear=Cluti;member1985.~~ . , REFERENCES ~ ~, ..• ~,~ i .. - ... ~ . >. ,. ,. :` .., , Provided upon request. t~ ;~~. it t ,. _ "~ ~. . 90 Coastal Healthcare ~ • - Consultants . PO Box 3472 ~ ° , . ,° ,~ Wilmington; NC 28406 ' Joseph L Soto CHE President .Hon. Bill Caster August 11, 1998 New Hanover County '' ' Chairman Board of Commissioners • _ 320 Chestnut .Street, Room 305 ~ _ Wilmington, NC 28401-4093 - Dear Commissioners . ~ I respectfully request your support and. consideration for my_ application for appointment to the New Hanover Regional Medical Center board of trustees. I wish to serve on this board to enhance NHRMC regional role and continue my twenty years of service to this.community's 'health care system. My concerns are the implementation work that remains. to be done with the goal to have the most appropriate health care system for our community. One which ' maximizes .the valuable health care resources that this community has developed into a cooperative system that enhances patient care service and reduces. cost, .especially to small ' businesses. ~. ~. haddition to my formal qualifications which I have included. I am uniquely qualified as a practicing health care financial consultant to help the board understand the complex issues that NHRMC will have in the future. During the past four years I have had an active leadership~role in .the implementation of the Coastal Carolina Health Care Coalition and served as the treasurer. This.Coalition has demonstrated b , workin . together the hos itals- P ~_- _ y g ' ` can.improve efficiency and reduce the costs to patients. ' I was the co-leader with past administrations of the 1994-95 five county health planning . project. This project has identified many opportunities to improve the health of the people of southeastern North Carolina. During the past twenty years I have had several - opportunities to work with NHRMC representatives on successful nonprofit community health care boards; such as Hospice, Hospital hospitality house, Project 2040 and Red Cross boards. I served faithfully for fifteen years as member of a community hospital - .system board with twenty all volunteer board members. I have demonstrated my ability to~ work together for the common good by initiating the first joint hospital NHRMC and CFMH board planning retreat in 1994. I clearly understand the role of board and' adnunistration. Because of my past competitive relationship I will gladly sign any conflict of interest or confidentiality statements desired ., by the current board or administration. ' Sincerely... _ . ose L to CHE ~ -.: _ ~ . - ~ .~ `.J . . QUG ] ] .1998 ~ ~~ NEW HANOVFR COUNTY BOARD OF COMM/SS/ONERS *~ - 320. Chestnut Street, Room 305 - ~ - - ' ' Wilmington, NC 28401-4093 ' - ~' ~''~~" Te/ephone (9101 341-7149 - . FAX (9101 341-4130 ~ .: App/ication for Appointment to Boards, Committees,,.and Commissions Appointed 6y the New Hanover County Board of'Commissioners, ' Request for Appointment to: Name: ~ William C (Bill) Ta Home Address:, ,125 Partridge Road Mailingl ddr Hanover Res or - ~ ~ - oval Medical Center ;r - !; ass. T25 Partridge Road .. ~ , How./ong:have you~been a •~ _residen.t of New Hanover County? 35 ears City and State: Wilmn ton, North Carolina Zip Code: 28412 Telephone: Home: _ (910) 791-1432. '• ~- ~ Business:, ~~ (910), 392-160.0 - .! : ~ ',, "Sex: ~ Male "Race:.. W ,, ,; .A9e . 'This information is requested for the so/e puipase afassuring that a cros ssection of the communit isLLe~ ",Em /o edb ornted. ~ ' - p y Y~ Blue Cross and. Blue '.Shield,~of North:.Carolina will. yeti=ze ,~~ 15-94 ".4 persomrurrent/y amp/byedby the agency or department for'which this app/ication is made, must resign his/herposition with New Hanover County upon appointment, in accordance with Article Vl, Sec. 4 of the New Hanover County Personnel Polic . . Re Tonal' Director ~ ' Professions/A'ctivities.• ~ • ~' ' r _ ~ 1 1 ' Vo/unteerActivities: Trustee ''Ca e ~ Fear Community College ,(term expires 07-01-96) ' Why do you wish to serve on the Board, Committee, 'or Commiss/on requestedT ~ To .help t-he people of New I 4 ~ vet Count to receive the Best Health Care Possible At A Reasonable Cost' What do you feel aie yournqua/ifications for serving on the Board, Committee, or Commisssion r equested~, past member and chairman Cardinal Health Agency; 40 years with Blue Cross and Blue'Shield~,of North Carolina; Past New Hanover County Commissioner ' What areas of concern wou/d you like to see the Board, Committee, or Commission address? '. Are you currently serving on another board or committee appointed by a municipality or a county? /f so, please list: - n/ ~ Gov. Martin a oinred me to Trustee at Cape Fear Community College ~~~ " ~ ~ Date: ~ , ~~~~~ 1: (Please use avers side fo additions/ con~{l~n~ ~~~~~~ n , 1 7 C~ r~ ~,,. F„ ~.~n,,,ER CO. - :~ =!L~NEP,S Signature fi .. + .. . NEW HANOVER COUNTY • ' ~ Bc7ARD OF" COMM/SS/ONERS 320 Chestnut Street, Room 305 - Wi/m>ngton, NC 28401-4093- Telephone (9101 341-7149 . - F.4 X (9 101 34 1-4 130 App/ication for Appointment to Boards, Committees, and Commissions • - Appointed by the New Hanover County Board of Commissioners. Request for Appointment to: 2 l~ (~ }/ P, e Name: I 1 ~ ~- ~-0~ `Home f ` How long have you been a `Address:' I t ~I (~ F~('e}/>, L ~\ ~ 0 ~ (~ resident of New Hanover Count l \~ y 5 ~ s. .Mailing Address: ~ ~ (~ L ~`~C' ~C ~ r~- ~ GC City and State: - ~,(~ 't ~ 1~ ~ ~n ,~ ~ ~ (~ .~ 1 Zip Code: _ ~ ~ y Q ~ ,Telephone: Home: _ l ~~ - ~~ ~ - l ~ ~ ~ Business: : l ~ (~ - ~-f- _, f' S a 'Sex: j ..Race: ~,(~ .'This information is requested Jor the sole purpose of assuring th~~ cross-sect~n of the community is a ointe /] ~ V PP d. "Erriployed by: C A e ~~~r . . 'A person current/y amp/o yed by the agency or department for whit this app/icauonls made, must resrgn h!s/herposition with "New Hanover County upon appointment, in accordance with Artic% V/, -Sec. 4 0l the New Hanover Count . y Personne/Policy. . .lob Title: ~ ~ .. _ c`~• tecc}~r, C~rc}; cc~\i'v, ayc ~unc~ Professiona/Activities: p~ 1 `I ~, ~ I; , 5 /r ~/ R~~h~l~~ s. -u hD ~ ' Y( 1 l2 FiYv, S,Jd y~ ^ Vq/unteerActivities: .~~}~j~ •.~ ~ (-~- - r, /~~C~1-eyerner\t, I ski y!~( ~f~ Tf.PS Why do .you wish to serve on the Board, Committee, or Commission requested? ~~'2 ~ ,> `~ Y l 7/~ ~~~ ~ ~_ o ~ (,c.~ ~ ~ vo V r } /t. ~~ e ~ ~ ~ ~ J ~1l~ L -fir S p~ .-~1 ~.. . What do you fee/ are your qualifications for serving on the Board, Committee, or .Commission requested? _~~V~ e Y.~ C~ X~(J r f l P >1' P ~~ ~ ~ -~ ~ ~ f .s f~'r Q e o~- ! BIZ 1~,~ cr r,~ ~ , • A;~///~ ~ /f y~c~r~ '~1X~Pr~Pi~{ C U-5 C~-D -~d ~' C J!'~v~rC'rtin ci'fi-P ~/ What areas of concern ,would you like to see the Board, Committee, or Commission address? Cj ~ . ~~ ~i :J, i ' :4 re yo'u current/y serving. on another board or committee appointed b y a municipality or a county? /f so, p/ease. list: , d f . D - - _ ~ ~ 9 ~" --- (P/ease use reverse side for eddilione/ comm~nlsJ SEP ~ 1998 Stilnafure . E`~ `': ';~t':., C~~. (OVER) NEW HANOYER COUNTY • BOARD OF CQNIMISS/ONFRS - - . 320 Chestnut Stieei, Room 305 Wilmington, NC 28401-4093 Te%phone f9fD1 3s1-7149 . . PAX t9roa 341-4130 App/ication for Appoinimeni to Boards, Committees, and Commissans Appointed by the New h(anover Caurtty Board of Commissioners: Requost /or Appointment to: New Hanovex Re~ic~al Medical Colter $oard of Zhistees Name: F. S null Thom son '-- . . .Home Kow lonD have you beery a Address- 901 .Twisted Oak Place (6/1/98) ~ yesidQnt of New NdnOVQ/ COUntyl 6 years • Mai/inp Address; -Post Office Box 5 Wria.,hisville Beach, NC 28480 ~ • • G'ty andStalq:~ Wilnungton, North Carolina Z;p Cade: 28405 7e/ephone; Nome: 910-313-0737 Business: 910-256-6999 'Sex: Male' .Race: White . 'Ape; 36 '71/s ;n/armsl;on is i.puwrt.d /or rh• svl. p~wpati o! Ksc~i~y Cl~l ~ Crass-s~Cdan of dF. cwnrt+urH 'ry k ~pao;nr~d "Employed by: 1st Atlantic Properties, Inc. • • •A pKSOn rwr~n tl y ~n~p/a ysd by M ~ eQ.nry a~ dp~rlm.n t tar wliefi 04is ~pplicition it Wadi, Hoer! ra; N.w Nana Counry uporf Apo/atmsnG h •~COra~ne~ wltA ~lrGt11 V/, Sit. ~ a/ (A. New N. ¢" 1-~Kp0.t;Gan w;N now Cow1ry ~sonn~t r'uicy, • Job Tit/e: President, Owner ." °.. P(otassipnalA~Iivities: Chamber of Commerce; Committee of 100, Ro ~olunteelActivities: Bo Scoutts, Fund Raising, VMI Soccer Cam aign 4'/hy do yov'wish to srrve on tht Board, Committee, or'Commissiorl requestedl I feel a civic obligation to . partici ate rather than to sim ly give financial ort to worthy organizations. . What do you fee! dye your qup/r'frcetions for servln~ on tht Board, Committee, ar Commies%on requesttdl My constant interraction ~~~ith t1~e community affords me an objective view from the public. .What areas of concern world you /,ke to see the Board, Cornmittte, or Comm,'ssion addr¢ssl ` I feel that • responsible fiscal and facilities management ~i711 be an ever presenl challe tee. Are you cu{renrly secvinp on enathcr board or tomrru'rtee eppointCd by a muniti al; , P ty ar a,cour2tyl /f so, please list: .: No. , DaQgl28/98 . , tA~st~ us• rw~rsr sidt /a ~dd;riona/ comm.., ti S+'pnatWe ~.-~r . ~~~~1~~ (OVER) •_ . ~~~ ~1ov~~ cQ, 9 ~ . ` ~. ~~ ~ ~?AM1SS10N;~ 7 Y t' _ - Frank Spruill Thompson ' P. O. Box 5 Wrightsville Beach,'NC 28480 (910) 313-0737 z• " EDUCATION: Bachelor of Arts degree in English; Virginia Military Institute, May 1984. Additional concentrations in History and Psychology. WORK EXPERIENCE: ,.r Feb. '95 -Present Owner, President of 1st Atlantic Properties, Inc., Wilmington, N.G, !Broker-In- Charge. Responsible for the operations and marketing efforts of the company.including achieving the company's goal of a $20 M portfolio'within~the first 6 nth mo s. Operations include budgets and performance tracking as well as employee morale, motivation and productivity and requiting. Marketing efforts include confidential representation and s l a e of healthy ongoing businesses. This includes the solidtation and pre-qualifying of buyers for the acquisition of businesses. Responsibilities also include negotiation of leases and coordination with attorneys for a successful transaction. Oct:`•93 -. Feb:"'95~ ~'." ,. ; ; ",.Sales and Marketing, McWhorter Properties; Wilmington; N.C. ' .: ' ~ Responsible for the confidential representation and sale of health on oin bu ' .../ y g g smesses. This includes the sohatation and pre-qualifying of buyers .for the. ac uisition bf b , ; q usinesses. Responsibilities also include' negotiation of ]eases and coordination with atrorneys for a successful transaction. Business development for the reczuitanent of listings,. as well as buyers and tenants includes coordination with restaurant franchi nd o sors a ther Fortune 500 companies. June '93 -Oct. '93 Sales and Marketing, Intracoastal Realty Corporation, 4Vrightsville.$each N C , . . Responsible for the confidential representation and sale of healthy, origoing.businesses. Also responsible for the rea-uitment of commerdal facilities for sale d l ' an ease . This includes finding tenants for these commerdal fadlities. " April'91 -June '93 Sales and Rlarketi~ig, C.J. Harris and Company, Inc., Greenville, N.C. , Responsible for the confidential representation and sale of healthy ongoing businesses. This includes the pre-qualifying of buyers for the acquisition of businesses up to 12 million in sales and 1.8 million in consideration. Responsibilities also include negotiation of leases and coordination with attorneys for a successful transaction. Jan.'86 -April '91 Sales Representative, Deluxe Check Printers, Greensboro, N. C. ~ ' Responsible for sales to finandal institutions. This includes cultivation of marketing campaigns for checking account programs as well as training and education of personnel on products and services. Received Summit Club Award, August 1989. March '85 -Dec. '86 98: Sales Representative, John Hancock Mutual Life Insurance Co., Charlottes N.C. Responsible for sales of individual and group life and health insurance. NFW NANO . V,ER COUNTY._ ~ , . ,, -, , r ~ - • B 0.4 RD OF COMN1/SS/ONERS~ 320 Chestnut Sheet, Room 305. . ~~..Wilmington; NC ''28401-4093 ~ ~ ~ ~ ` ~` '' 'Telephone (9 101 34 1-7 149 FAX (9101 341-4130 Application for Appointment to Boards, Committees, and Commissions Appointed 6 the New. Hanover County Board of Commissioners.:"" ~~ 1 ~-~ / ~o91ZC: O Request for Appointment to: 2UJ ~~#~-~Oi1~,~ Q, 1O~gL Q~;CA~ ~y •~ Name: 2 k ~ {~ . . W t (tom ~t ~ S Home q l " ` Now /onp.have you been a Address: I 1 vI 1~'~ ,Z~ d ~ ~k t~l•.~ ~ . ` 'resident of New Hanover County? ~ z y e;~-~S Mailing Address: D ( ~~~,~ h ~~e - ~ . ~. City and State: `` ~ ~~ -- ~)..J 1 ~ ryti ~ rlf'q ~~ rJ Zip Code: Z ~ ~ ~ 3 _ .. t, . . Telephone: r .Home: 7>- ~- -~ - ' O`7 ~ ~ _ ~ . Business:. - ~ ~ 1 S - Z ~ ~ ~ . 'Sex: ~A~Z 'Race: ~~C~SiA./ 'Age: -~8 - _ • ;.~ ,. 'This infarmerion is requested /or the so/e purpose oressuring t~he/t'e cross-section o/ the community is appointed. - -Emp/o yed b y: ~~~A~C f~L~ />t7 n/ ~ • ~T' ~/2c'` s- ~ ... ~-U . ' 'A person current/y amp/o yed b y the agency or department for which this app/icetion is made, must resign his/herposition with New Nenover County upon appointment, in accordance with Arfic/e V/, Sec. 4 0/ the New Hanover County.Personrie/Policy; ~. Job Tit/e: ~e io,~,~ ~ C,.-0~n ~~~~~~~ ~~~//~-~/c' y ,/• "~ . / ~/t- 7. c ~ /izcS Professional Activities: N' C, /~,o,~ ~cJZs ~ff~, L , /~ ~) /~ VolunteerActivit/es: GL.t/C'sc/ ~'" _/ / / i4'~t /_U CL/1iC~ii7i V/1 /-~Gi .y /2 ~[ ~'/jtr 1,/'~J --~-- /'~ n/ ~,L L ~ l-C-~'•vt.~ ~.t^..•y. G'-.Lam L,r7~9r+-~ h L/Z_. o CQ „~. - b v'L C L F«,,.~~ rri ~.../ / z•d,~ d,. 3`' ~ S c-a a ~`S o ~ Ah G,z : c-.9 Why do you wish to serve on the Board, Committee, or Commission requested? e,z ~J~,~;,," L~ ~~~~.z~ ~ 3~ LAP-/J/ZS ~.v~ /itr~./ ../ lif,~~issirvc ~v/V ~.~ z ~ L' e~g1ZS 1 rZ.i~L ~ ./ ~.~' „~_an/ ~ ~r p erz; eNc e ~ ,a tick ~,/at~~ rg/>~.2o,sc~. ~~ /hil 6cA,2d Wha/t do you fee/ are your qualifications for serving on the Board, Committee, or Commission requested? vz ~ e,..,c ~ f ~ ju G itf 2.. .~C iN ~ i~/S/ c-i~ d R O cc.~2 /~`L'~~ ; ILir /f / Ui.~-/ c1.N . Wh/a~t areas of concern wou/d you like to~'see the Board, Committee, or Commission address? /-%~ t~s o 7'` ,q o-t n~,Z Gan~.~ c_...iZ~:PJ' .:ti' ~OC.<-7"L~~-s s7"c.e,~j /ti', Ca2~/.',/.q .a -/ Are you current/y serving on another board or committee appointed by a ~ Cipa/%ity o a county//soaplease st~ fs, ~~ Date:- ~ L ~ / 9 ~~ !P/ease use lave or eddi lone/ comments/ .....' .: 'L i - ~ 1996 Signet ....... ~,i•` ~ G~. (OVER) BIOGRAPHIC INFORMATION:-JERRY L. WILKYN.~ NATIVE OF DUNN, NC AND CURRENT RESIDENT OF WILMINGTON, NC MARRIED TO ANDREA JO WLLKINS ONE SON -JERRY L. WILKINS, JR:; AGE 24, GRADUATED UNC-CHAPEL HILL. CURRENTLY ATTENDING CAMPBELL UNIVERSITY LAW SCHOOL~`~ " - ', GRADUATED - DUNN HIGH SCHOOL, EAST CAROLINA UNLVERSITY _ • (MAJORING IN BUSINESS ADMINISTRATION AND ECONOMICS) GRADUATED EXECUTIVE PROGRAM AT~UNC-CHAPEL HII.,L` •• - ~ • - SENIOR VICE PRESIDENT OF BB&T SERVING AS REGIONAL CORPORATE BANKER PRIOR TO BB&T -WORKED FOR UNITED CAROLINA BANK. MR. WII..KINS NOW SERVES ON THE BOARD OF DIRECTORS FOR THE CAPE •FEAR CHAPTER OF AMERICAN RED CROSS AND HAS SERVED AS CHAIRMAN OF THIS BOARD IN THE PAST. WILKINS HAS SERVED ON THE UNC-W FOUNDATION BOARD, AND HAS SERVED AS CHAIRMAN; CAPE FEAR ACADEMY BOARD. PAST CHAIRMA,'~1; .GREATER WILMINGTON MERCHANTS ASSOCIATION; GREATER WILMINGTON CHAMBER OF COMMERCE; PAST BOARD MEMBER OF UNITED WAY BOARD; AND OTHER BOARDS THROUGHOUT HIS.BANKING CAREER. WILKINS PRESENTLY SERVES ON THE CAPE BOARD (CONSORTIUM FOR THE ADVANCEMENT OF PUBLIC EDUCATION); CHAMBER OF CO1~~~RCE FOUNDATION BOARD; EXECUTIVE BOARD FOR BOY SCOUTS; WILMII~'GTON EXCELLENCE COMMITTEE; WII.,I~ffNGTON BUSINESS COUNCIL.., AND RECENTLY APPOINTED TO THE BOARD OF THE CAPE FEAR YOUTH DEVELOPMENT VISIONS, INC. MR. WILKINS IS ALSO A MEMBER OF THE WILMINGTON EXECUTIVES CLUB. ,1;02 ,. - B ~C&T . Branch Banking & Trust Co. P.O. Box 1727 Wiimington, NC 28402-1727 .. (910) 815-2700 ,. `/ - 7 ~0~9~ . June 6, 1998 ~ - ; Mr. William A. Caster Chairmen of County Commissioners 310 Brookshire Lane Wilmington, NC 28409 ~ , . Dear Bilh ~ - . Please find a copy of the application I have submitted for consideration to an appointment for the Trustee Board at New Hanover Regional Medical Center. I would only ask that . you review this application and recognize the strong interest 1 have in being able to ` ~ possibly serve on this board. Recognizing in advance there will be a Iot of interest in this > • board. as the hospital represents such a large part of-our community and financial strength of our county. . I would only ask that you give my application yourconsideration as I am sure you will all oftlie good applications that you receive. The intent of this letter is_only to express m}~ ' interest in serving on this board. Bill, thanks again for any consideration you would give my application for appointment to than,;board: Sincerely,- _~ ~~ Jerry .Wilkins ~ ~ ,; Senior Vice President cc: New Hanover County Commissioners . ~. . .; 103 NURSING HOME COMMUNITY ADVISORY COMMITTEE . ~ ~ ~ .. . <. . .. . } ,..; VACANCIES Attachments Committee Information Sheets Applications r, 1~~0~4~~~ NURSING HOME COMMUNITY ADVISORY COMMITTEE Number of 'Members : 13 One-third ~of the: members may be nominated by Nursing'Home Administrators: Number of members are determined by the number of.Nursing Homes in County... .The immediate family of a patient in a home may not. be a committee. member or persons with a financial interest in .a home: served by'the committee. °,. Term: 1-year term initially; 3-...year terms thereafter _ . Compensation: none ~. Regular Meetings called as needed ~ . Statute or cause creating Board: N. C. General Statutes 130 . _~ Brief on the functions: Each member shall be aware of the general conditions under-which the persons are residing in the homes, and shall• work for the best interests of the persons in the ;homes. This may include .assisting persons who have grievances-with the home and facilitating the resolution of grievances at the local level. Each member shall make. quarterly'visits.to the nursng.~.home:it... serves .and .more often if it is necessary to carry out the duties. ~ , TERM . PRESENTLY TERM CURRENT ME~iBERB SERVING E%PIRES .Catherine R. Davis First 5613 Greenville Loop Road 2/2899 . Wilmington, NC 28409 (Appt..2/2/98 to 1.year.term) 395-5512 (H). 350-2100. (W) Dedre B.. Freeman .. First 2/28/99 ~,~ 15 N. 25th'Street .. Wilmington, NC .28405 (Appt. 2/2/98 .to .l .815-3491 (H) 772-6755 (W) Year.term)'~ •Edward V. Grace First 2%28/2001 `301 Honeycutt Drive (Appt. 2/2/98 to 3-year term) - Wilmington, NC 28412 . 3.92-5692. (H) . Anne Har way." First 2/28/2001'f. 1951 K llwood ~2oad Wilm' ~ {Appt. 2/2/.98 to 3-year term) gton, NC 28403 76 62.9.5 (H) . ~ 0~ ' NIIRSING HOME COMMIINITY ADVISORY COMMITTEE (CONTINIIED) .. ~~ -. _ TERM PRESENTLY '_TERM CIIRRENT MEMBERS ' .SERVING -~~E%PIREB John.. M. Horton. ~ ~ ' . ~ ~- ~ ~ First .,. 2 /28 /2001 P. O;M Box 891' 1 . `.. (Appt.. 2/2/98 ~to _ _ 3-year term) 203 Green Bay Circle ~ -- , Wrightsville Beach, NC 28480-0891 ~ 256-5150 (H) ~ 251-0440 (-W) .. , `.., .. .,;_ „ ~_ Clara W. amb First 2/28/9.9 401 N. hind Street Car ina Beach, NC 28428 ~ .., . ~~(Appt. 2/2/98 to , . ; , 1 year term) 4 -5282 (H) ~ " s.. ~~ .- . - Herb McDuffie . . First 2/28/gg 514 Brunswick Street -- ~ ' Wilmington, ~NC 28401 ~ ': 7 `~ (Appt., 2/2/98 toy -1~ year term)Po 63-.4372. (H) 251-3645 (W) ~ ~ ,- ,i ; Eileen B. Rock ~ ~ ~` ~ First ~~ ~ 2/28/99 :.~ 2614 Columbia Avenue Wilmington, NC 28403 2/2./98 to 1 yea~r:aerm)~. - 762-5103 (.H) .,:... T . . ~ . - John D. Sabo First 2/28/99 1312 Burnett Road Wilmington, NC 28409 0 (Appt. 2/2/98 to,f 1 year term)=•~-` 350-268 .(H) - . Kathy,Vi,v a ~' 7503 P er Wa First ~ ~~ '2J28/99 . y Wilm' gton, .NC 28412 ~~/c~~Q~ (APPt• .2/2/,98 Ito ; 1 year term) 3 -1936 . Lyn Williams-Yow - First 24/'28`/2001 610 Dock Street (Appt. 2/2/98~.to 3 year term) Wilmington, NC- 28401 763-3890 (H) 753-5558 (W) Nominated by Nursing Home Administrators: ~ .. ~ ,- • V Teresa D. Goldston First ; 2/28/2001 4801 Oberbeck Way (Appt. 2/2/98 to 3-year term) Wilmington, NC 28409 ~, 350-0:62,9 (H) Ernst M. Swart First ~ 2/28/+2001 203 Eggert Avenue Castle Hayne, NC 28429 (Appt. 2/2/98 to 3-year term) t ~....~ 67' ~~~70 (H) NEW NANO VF'R COUNTY BOARD OF COMM/SS/ONERS 320 Chestnut Street, Room 305 ' Wi/mington~,NC ..2401-4093 - ' .. - ~ Telephone (9 1 01 34 1=7 149 FAX (9101 341-4130 ~' App/ication for Appointment to Boards, Committees, and Commissions • ~ - ' ' Appointed b y the New Hanover Count y Board of Commissioners. Request for i l ppointment to: /ki u ~ S' ~,~t ~ „? e C a M _~~ /f j /'7 GC .Uc /~/ /IZI~ U S'y Y S/ ~D/'7 /~ i ~~'F' Name: Home ,. b G ~-c~ ~~~ Address: I~ 9 ~~ p rY1 (,~ 2 l1 C t r C ~~ Mai/ing Address: ~it m ~. GZ S ~,~rn ~ How long have you been a esident of Nevv Hanover County? ~~ City and State: CJ ( ~ m . ,,~ ~, yrJ C Zip Code: _ ~ ~ yo j Telephone: Home: ~/d ~ ~ ~ f" - i~rS751 Business: `Sex: ~' `Race: -~, L~ ~1~~-~ 'Ape: _!> ~" . 'This in/ormetion is requested /or the solo purpose of assuring that across-secfion o/ the community is appointed. ` `Emplo yed b y: ~F ~ r e cl "A person current/y amp/Dyed by the agency or department for which this app/ication is made, must resign his/rierposition with New Hanover County upon appointment, in accordance with Artic% VI, Sec. 4 of the New Hanover County Personnel Fb/icy. ///. Job Title: Professiona/Activities: _ ~~ s ~ ,~~ ~o Y Vo/unteerActivities: _/~D S 'f l y ~ ~L tJ r c ~,~ ~~ ~ ~~ ~ Why do you wish to serve on the Board, Committee, or Commission requested? -~ ~^-- /C% ~-~ r ~ r .u /`i`ce rl ~ S C%n a( ~- LJ cam,( ~t ~ ~ ~e_2. ,~~~~~~ . What do you fee/ are your qualifications for serving on he Board, Committee, or Commission requested? l~ c~ ~~J ~ ~~v ~ r ,~ct ~~--~~w ¢-- ~ Grt Wh~t'areas o/concern would you like.to ee the Board, Committee or Commtsslon address? `-~' ~" a~L/~~-.--~ ~oZ' c( ~G t~ °~ i~'f . Are you currently serving on another board or committee appointed by a municipality o/ a county? if so, p/ease list: f/ v , r~r-----,~ - date: -X~ (~~-' . ~ /c~'~ BUG 1 1 1998 ?/ease use ers e r edditione/ comments/ +tiJ Signature ~ (OVE ~:~1 r.. 1'' NFW HANOVER COUNTY . B DA RD OF COMM/SS/ONFRS 320 Chestnut Street, Room 305. Wilmington, NC 28401-4093 - Telephone (97 01 34 1-7 149 ~ ~~. ~ -;;,~ ~ . FAX (9 101 34 1-4 130 App/ication for Appointment to Boards, Committees; and Commissions Appointed b y the New Hanover County. Board of Commissioners. bequest forAppointmenf to: n,,,,-~, .,~ „___ ,. _ _ . - _ - ~ tee . vane: Elizabeth W. ]31and ~ ~ .,. 'dome ~ , How ton have ~ ' addiess: y ~i 7 "'cr,~+,.,; „,a ,, ~ You been a ~' resident of New Hanover County? 66 vrs tdailing Address: same _ ~ity and State: _ Wilmin -ton, NC telephone: Home: ~3 9 5- 2 2 5 6 Zip Code: 2 8 4 0 3 Business: 256-6602 'Sex: Fema~ ~ - 'Race: Caucasian 'Age: 66 'This in/ormetion is requested /or the so/e purpose o/assuring that across-section o/ the community is appointed. "Emplo yed b y: _ 'A person current/y amp/a yed by the agency ordep~rtment /or which this application is made, must resign his/her position with New Hanover County upon appointment, in accordance with Attic/e V/, Sec. 4 0/the New Hanover County PerSOnne/Po/icy. _ Job Tit/e: Realtor-Owner 'rofessiona/Activities: Members Rotary-Chamber-)3rd . of Rltrs-\'. Pres . y„ (former) treasurer- 'o/unteerActivities: Mission trips-1)abitat for I)umanity-formerly-Crisis Line-Rotary /hy do you wish to serve on the Board, Committee, or Commission re uestedl 1 1 ies q I feel .I have the ability to make a positive contribution. I was responsible for care of an aunt for 3 years in the nursing home community. hat do you fee/are your qualr'/ications forservinp on the Board, Committee, or Commission requested? Served 8 rrs as elected member of Soil Conv Service-6 as Chairman-Former Presi-'3ent=- :hamber of Commerce-Pres-A]3WA- 1t. Pres-)3rd of Rltrs-Director-Comm 100-Yw- :hamber-lard of Rtrs-former Entrepenure of the Year hat areas of concern would you like to see the Board, Committee, or Commission address? • ~~si ~t i n ~ssurin5 the residents that their needs & rights are liven full consic?eration. e you current/y serving on another board or committee appointed b y a municipality or a county? if so, please list: ` ------- °te: 8- 9 9 AUG 2 8 1998 `~Z~~.eo`~'~ ~/L,~'C~a~ +ese use reverse 'de 1 dditionel comments/ SipnatUre .e sr, q, ~.,.-.,, s`~ FtY.~I• ~YL'~i ;.1. (OVER) ...........,..... _, ~J . ' REFER~~,~,5 P/ease provide three- /o'ca/persona/ re%rences. .. Name ~. Phone Number 1J ~ • 1111eri O'Neal •, - , - '- 341-7184 ~~ 2f . `. Dan Cameron. _. 762-2676 3J. ' . Dumay Gorham ~ 763-9891 • - _~ ,, . . ._~. - , . . f ~ ~ .•.. ... _.~ . .. . .. .. 1 ~.. /-C~iZ L- Ci 1 ~ l/~~l JCC-F..._C".Y 4 ~.~ lz- ~_> ~'ZC~ ~ /~~~ /c7 /G7~ / J . ~~-1LC, ~1 ~ U~ Lfic 6 n'I ~ up-srr~ ~'`' ~ NEW NANO VER COUNTY BOARD OF COMMISS/ONERS , ~,~ 320 Chestnut Street, Room 305 '..C~~~~~ ~ Wilmington, NC 28401-4093_ .- , : ~ ' - - ~ ~ ~ . ' ` ~S _1 uC~, C~,~ Te%phone (9 1 01 34 1-7 149 ~) FAX (9 101 34 1-4 130 Application for Appointment to Boards, Committees, and Commissions . ~ ' Appointed b y the. Ne w Hanover County Board of Commissioners. Request for Appointment to: f /V _ d~~ (~ ~ .~ ~ - o .. _ (~/Saf4 ~ ~a life Name: O f~ U °c. ~~ /9/~-y ~ ~ , ~ f~/~~~ / S .. , Nome ~ How /onp have you been a Address: ~ ~ ~ ,~e~ e ~ ~ ~ ~ resident of New Hanover County? S Mailing Address: ~~/Y1~. City and Stater _~,~) iL ~n 1 /1) 9 fo/y !~ e Zip Code: o~S CY y d S Telephone: Home: ~~Q - ~ 9 ~ - ~ ~ D 7 Business: _ ~ fG(,D eN-f"- ~reC e 'Sex: ~ 'Race: ~ 9 ~'S NLl~~I~ ~.5.5/S~l~NC -e__ - ; A e: This in/ormetion isnrequested for the so/e purpose o/ assuring that across-section o/ the community is appointed, •'Emp/oyed by: ~7 - - - /~ ~ ~f~e ~e~u -f- ~ ' 'A person cur ant/y amp/oyed by the agency or department for which this epphcaLon arcade, must resign his/her position with New Hanover County upon eppointinant, in accordance with Artic% V/, Seca 4 0! the New Hanover County Personne/Policy, Jab Tit/e: - - Professiona/Activities: VolunteerActivities: --- Why do you wrish to serve on the Board, Committee, or Commission re uestedl ~' - _ q ~L~EQ1 S u ~ ~. ~ ~ ~ o v~d ~ .n ~~ss/s ~ a.~U ~fi eu N~~ ~ o i ~ ~ ~i~~f ~ m ~~ What do you fee/ are your qua/ifications for serving on the Board, Committee, or Commission requested? _~, R I /v 9 j ~ ~d~ ~'A~ ~'om /~i~ SS/off ~o/Z l~.l l2 ~E'U/D!2 ~ /~/z~,vs What areas o/concern would you /ike to see the Board, Committee, or Commission address? ~~aR e55 a1v~-enNs /a ~op~12 /~l.Cff~ol3/~/mss ~~~R~the~ % vas-tl9Atlo,~.~ d fjSeRU~ t~~Ns ~--To C'of~t~ect-5 Are you current/y serving on another board or commrtee a R~(~2e' ppointed by a municipa/ity or a county? //so, p/ease /ist: ~l l ~ __ Date: ~/~-~I ~~07-' / ! `~~ (p/ease use raver s (jpr edditione/ comments) ------ Signatur G (OVER) NF'W NANO VER COUNTY BOARD OF COMNIISS/ONERS 320 Chestnut Street, Room 305 Wilmington, NC 28401-4093 ... ~ "~ Te/ephone (9101.341-7149 FAX (9101 341-4130 ,. _ . ,•• :~ App/ication for Appointment to Boards, Committees, and Commissions t _ Appointed by the Ne,w, Hanover County Board of Commissioners. Request for Appointment to: ~, ~ ~ ~ ~ • __ YNi1 Name: ,.. ~ ~ - • Home ~ ' ~ _ ' ~ ' ,_ ' ' ' " ~ How /one have you been a Address: ~ ~~/.9-- resident of New Hanover County? .~` M,ai/ing ,^, ddress: ~~;~.. a _-~~_ ,. City and State: ~ } ~~; C___ .Zip Code: _ ~ ~ ~(1 3 Telephone:. Home: _ ~GV3 - ~~ ~3 - Business: _ ~ - 3 `/ 9 0 'Sex: ~ir~~ -Race: / -Age: ~ 3 . 'This in/ormetion is requested far the so/e purpose o/assuring that across-section o/ the community is appointed. 'A poison currently amp/oyed b y the agency or department for which this app/ication is made, must resign his/her position with New Hanover County Lpon eppoin~menf, in ccordence with Artic% V/, Sec. 4 of the New Hanover Coun(y Personnel Po/icy. • :. .. .- _ Job Title: Professiona/Activities: ~~ ~., ,, ~ ,~ Volun leer A cti vities: Why do you wish to serve on the Board, Committee, or Commission re nested? ~' '~ q 1~.~~y .~ rte., 1'y " What areas of concern won/d you like to see the Board, Committee, or Commission address? .. ~ ~ n .~ _ .. ., Are .you currently serving on another board or committee appointed by a municipality or a o~ y~ s Date: ! ~ `^r' 0 9 1998 (Please use rave e ~ e or additional comments) , , _ , _ _, . l'1.~.. ~a.4 •^~ ~, ~~IS /~~- /is t: Signature / (.OVER) What do you fee/ are your qualifications for serving on the Board, Committee, or Commission requested? ~_ ~ ~~ ~1J-~ ~P SL~'Ip/I i a ~ TC` ~/G~ ~ ~~- Q- ~~l %~~/ a % :r n ~+(; F 0_ t NFW HANOVER COUNTY BOARD OF COMNI/SSIDNF"RS 320 Chestnut Street, Room 305 Wi/mington, NC 28401-4093.... Telephone (9~lOJ 341-7149 FAX (9101 341-4130 t, ,. App/ication for Appointment to Boards, Committees, and Commissions :., .. Appointed by the New Hanouer County Board of Commissioners. Re nest for A _ /~ /~ q ppointment to: - ,1 ~~~~~ ~ ) T/ ~,.~,~... (-, ~ •° ~~~ ~~~ Name:. rCC.-. ~ - `~ U ~ ~ .. - Home / ~'J r~ _ How /ong have' you been a Address: °z7L~~ / ~'0~1~~~° ~~l ~i ~ ~V ~` . ~/, resident of New Hanover County? ~" Mailing Address: ~ D / ' ~ ~ r r City and State: .~ J , n '~ Zp Code: ~~~ Telephone: Home: ~~ ~J~7 7/ rj/~~~ /;D~/~ Business: "T ~'" G _ 'Sex: `Race: ~) o~i ' 'Age: 'This information is repues(ed for the sole purpose o/ensuring that a cross-secti of the,community is appointed- - -Emplo yed b y: }'}'1 Y1.S - l1 r ~ ~ -' r~ ' 'A person current/y employe b y the agency or department for which s app/ication is made, must resign his/her p sition with New Hanover County upon appointment, in eccordenca with Artic/e V/, Sec. 4 of the Naw Hanover Coun( Personnel Po/ic ~ - Job Tit/e: r Td ~ l~~ y y.._ 1 Professional Activities: ~ ~~ ~ ~~ j ~~-h ~~-~ v,~- I ~ Q ~ \ _ Volume rAct-vities: ~ ~ _ ~V ~ ~~~~ .- a--~~~ ~~ ~. U (~ J Wh~d yo~is~ ~serv e on the Board, Committee, or Commission requested? ~~~ ~ ~ ~~~h---~-o I~e d' ~rv~-~-h~. ~ I~~~I What do you fee/ are your qua/ifications1 for serving on the Board, Committee, or Commission requested? l~C~ r t~~ c.h .~ ~rn ~ ~ r -~i eS hat areas o/-concer wou/d you l~ e to see the Board, Committee, or Commission addressT ~ ~ fin- s~ ~S ~~~ - re you current/y serving on another board or committee appointed by a municipality or a county? if so, please list: ., r I Date: tP/ease use rave e, i or additional comments/ Sipnatur (OVER) J ~~ o~I d APPLICANTS: .- Michael J. Keenan Darryl T. "Chuck" Langley Michael Powell Paul E. Ritchie Robert Franklin Smith, Jr. James B. Taylor Attachments: Committee Information Sheets Applications 1.1~8~ • ~ NEW HANOVER COUNTY PLANNING BOARD `~ ~ ~ ~, . , . "Number of Mecnbcrs: 7 " Term of Office: three years . • ~ f .. ~ Compensation:. , $20.00 per meeting ;Regular Meetings: First Thursday -in each month at 7:00 p.m. in the `Assembly, Room, 320 Chestnut Street, Wilmington, NC. Subdivision Review Committee meets-twice monthly on •' Wednesdays at 4:00 p. m. Statute ~or cause creating .Board: N. C. General Statutes 153A-321. New Hanover County Ordinance and Resolution establishing Commission dated September 2, 1980, for the purpose of planning and making recommendations in order that the elected,_and~ appointed .officials. of the County may competently perform their duties. ~ - Brief on the functions: -Make studies of the County and surrounding areas; determine- - objectives. to be sought in ..the development of the study area; prepare and .adopt plans for ~. achieving these objectives; develop and recommend policies, ordinances, administrative procedures; and other means fortcarrying out plans in a coordinated and efficient manner, advise the Board of Commissioners concerning the use and amendment of means of carry`ing.out plans; • .exercise any functions in the administration and' enforcement of various means for carrying out' :plans tha"t the Board of. Commissioners may direct; perform any other related duties t}iat the -`- - .Board of Commissioners may direct. Much of the Board's time is consumed with Land Use. Planning, .Zoning, and Subdivision activities.- . - TERM PRESENTLY .TERM . CITRRENT iVIEMBERS ~ ~ SERVING ~ EXPIRES :Kirk Davy' ~' First. 7-31-2000 2818 Park Avenue.. • • ...Wilmington, NG28403 (Appt. 7/21/97) • • 251-0606(Hj 256-6060(W). - Joyce Fernando .Second 7-31-99 ..4155 Appleton Way Wilmington, NC 2$412 ~ ~ (APPt. 7/26/93) . .. 799=3434 (H) (Reappt. 7/22/96) ." ' John".Edward. Galarde Second 7-31-2000 . ° 2001 Ivydale Lane Wilmington, NC 28405. (APPt. 7/18/94) 256 2700(H) - (Reapptd. 7/21/97).•. ,• _ ~ 119 ... ~ k ~ .. .a. ~ .. t NEW HANOVER COUNTY PLANNING BOARD~(CONTINUEDj'` TERM PRESENTLY x. TERM ~ ' CURRENT MEMBERS SERVING EXPIRES Rodney Q. Harris First 7-31-2000 P.O. Box 450 L Wrightsville Beach, NC 28480 (Appt. 12/16/96) 256-3004(H) 256-4475(W)' ._ Robert L. by ~ First ~ ~ 7=31-2001 400 Spi ush Court Wil gton, r NC 28405. ~.. a ~ ~' ~, .. (Appt. 7/2I%97) ~ ' 7 -0773(H) 452-4482 . ~ ~ - ~' (Reappointed 7/13/98) ~` McKinley D. Dull - ~ ~ First .~~ 'r ~ .~ ~ ~ 7=31-2001 314 N. Green Meadows Drive Wilmington, NC' 28405 - ~ ~ a ~ ~ . ~ {Appt. 7/13198) 791-9711(H) 395.-6036(W) .: ~ ~ - ~ ~ . . ~, ~ . .,, James E. Wolle .~ .. , . -. _ ._ _ . ,. Second ~ ~ ~ 7=31-99 5720 Oak Bluff Lane ~. .. -~ .. . • . ~ - . Wilmington, NC 28409 ~~ ~ ~ ~ ~ 7/2:6/93) ~- ' ` (APPt .392-0849. (H), _. -, ._ . t: :.; .. .~ .. ~ . ,-; . (Reappt. ":7/22%96) _ r - Staff Support: Dexter Hayes, Planning Director .. ~ ., 414 Chestnut Street; Room 305 Wilmington:, NC 2:8401 341-7165 - ,~=•~ . ` .. 120 -~~•- i-~ ~o u.J• co rrc wnunuvln-w1u i 71CIJ1JJJ4u I U 7J4141JCJ nrFw NANO v~R co~rvrY BOARD OF ~OMMISSIONF'RS 32t~ Cf~estnur Street, Room 305 Wilmington, I~1C 28:0 J-YD.93 Telephone /9701 3-~1•i;-s9 FAX ; 9 ; 01 3~ 1--~ 130 r. rJG~rJJ AppiiCaiion far Appointment io Boards, Committees, and Commissions Appointed by the New Hanover County Board of Commissioners. Requrst !or Appointmonc to: NeW NailOYer C unty_Pl anni no Board N2me: ~TCFt~el 7 eenan _ Name l~r'ow long have you be?n a Address: - G~700 Wedgefl Q1 d Drive rfsident of tYew Nar)over County? __ 27 .y.$drS total :: ~ ., MaiLng ,4ddress: 4700 FledoefQlel d .Drive ' ~ • City and State: Wi l mf ngtnn,~Nnrth ('.arnl i na Zip Code: 7A4~9 ' ~' Telephone? Home: 910791-6148 - -, 6uruness: 910-31.3-334 -. 'Sez: Mille ~ 'Barre: White •.i~e_ .. 37 .. _ - 'This rn/a rrnai;an s roQListed /or the sph purgos• of assn/;n4 (hit 1 e: ars•saction o! IAv co~rvnanrry ~S aDOOrn led. . "Employad by: ~1dC~10V1*~ Mortgage Compan ".a pA+SDn CCr/ran lty ornDICYe40y tha agency or dBDarrmant tar wAicA ftiS Jopl;c~Non is made, must rss;pn Risrha~pOl;rran wilR New Nanavar r'a urrry upon eppo;n anent, rrm aceo~G~ncv with Art%d, vr, Sdc. a of the Naw Honaver County r?ersarvn-l Poi;e y.. .loo 7<rle -.Construction Lendi n4 Officer -Vice President -. . Profess;onal Activities: _ Wl lmingtOR -Cape Fear Home Bui 1 ders Association - Volunr_2rActivittes: Saint Marks S CathOllC Church ~ . w.~y ao you wish to serve on the Board, Committee, or commission requested? I am both personally and ~. ~ ~.. ~. nrnfasSinnAll~ intaractprl in tha nnc;i'airA growth of NPw NannvQr ~ai~~Kr >>Sipg a onmmnn sense approach in dealing with planning issues. What da you feel are your qualiliCar;ons far serving on the fiodrd, Committee, or Comrvssr'on reQu2s:2d? P.-r~fPSSinnally I havA PxtQnsivP knnwlPCigP in the devPlnnment & lannina analyc,'s & f~Pl these skills would be benef1c1a1 in reviewing & resolvin~ conflicts during the approval bVhar areas of concern would you 1~ke ro sec the EDerd, omm;rree, or omm,~sion address? ----~rpCeSS Z would like to see a consistent approach used that is flair to all parties involved ire you current/y serving on anotnt'r rjoard Dr committee appointed 6y a mur.;crp3iity o/ a county? !f 50, p1eeS6 hsr: oar=- September 14, 1998 _ tr'•'SaT9 CS9 rO v9rlw Sides (ter aoCif~onar Garnman ls! 122 . Srgr. a tut e ,~ ~v V ._. w~-+u ~VVll-1. w. JL W LJW~V~ ~V JVIllLVV ~ - t -, ~ ~ ~ - ' ~. ... pleasd ptnvlde three local pecsdna! re(er~ncas: . _. Phone Number. . . , Name. .. } ~). . i 7J 01 m Hargrove ~ - 791-39fi b Raymond Stce] ton 395-5206 ~l . .. .. . ~ . . .. ~. t .. ~. ~ •.` ~. • • . .. ,.., :. 123•• ~i61c TOTRL PAGE. H3 ~lolc IVFW NANO VFR CO U/V T S' f30ARD QIc' C01i~1MlSSlON~ERS 320 Chestnut Street, Room. 305, - Wilmington, iVC 28401-4093 Telephone ~ 9101341-7149 FAX 191 Dl 341-4130 Application fnr Appoinimgnt fo Boards, Committees, and Commissions Appointed by th)e l4lew hfanoYer County Board of GDrririiissioners. Request lorAppoiniment to: -~- L~a r 1~ ~ ~+, p~•~:-. Name: ~~ ~1 7-' r t7 1 f I t ~ l ~ ~// ~ol L• Nome ~ ~ Now long haveyou been a _ Address: _~Z-O,~j }'>1 i Q~~ J~ 5p ~ r~,c~ ~~ resident of New Hanover Cflunty? ~ '~p ~- _ J Met7,'np Addiess:_ ~ [~ .~ L7 ~ ~ ~ Q ~ I ,-~ ~J Q'ty and Stste: W ~ ~ rlrl 1 't ~_ zip Code: ~ `'t-C..J ~ Telephone: Nome: ~ O ro J- -- ~ ~ O ~'/ W C5 _ Business: ~~ ~ - ~r,~ ~~ •Sex: ~ ~, "Race: ~~ "Age: _~~ 'This tnforrnel:on Is regvsa[~d forD[he ao% purpose of easur.nD the[ across-section ar tha rommunily is appolntod. ..Bmployed`bY: _ ~ ~~ ~, ~ ~"~., ~ Y' ~ Ol..~ ~ Q1 S~ t (~'~"'~~- f'. p ~- - Aporsoncvrrentlyvmp/oyvdbytftsagancyardepsrtrnmttvrwhlchth/sappNcat~oRls a, ltnius[res/pnhJs/hatpeSi[ipriwith New Kegovar County upon apppintmenf, irr accordance wit/~ Article Vl, Sec. 4 of [hs New He»ove! County Personnel Polley _.: . .. _ _ Job Title: - Y^ ~ -~ ~. -~~ y`-O~.Q ~1i-, n _ v Professional Activities: l.i 5' j O ~-~Y'o C.q~ St`s `-Q- ! ~~ ~ 1~A1ur1 teerAc hiss: a n'1 ~ t~+ ~ ~ i ~" ~o ~1 rn rn„C~~'c. G~~t t~:5 ~ ~c5i :~ ~ `~ ~ S Why do you wish to serve on the Board, Comrrrfttee, or (,ommission repuested? ~~ ~ , ~/.~ -~ J_ `' l T - What do you fee/ are your qualifications for serving nn t.'te Board, Committee, or Commission equ8stedT «.~~ ~Y-r^-.S J~ / What aare~a's of concern would ou /ike to see the Board, Committee, or Commssion address? ~ 1 ~~ ~ ~ a~ ~~ ~J ~~ a ~~ ~ r ~ -~ ,d re you current/y serving on another board or committe,~ appointed by a municipality or 8 county? If so, please list: J - ~ uv Date: ~ ~ ~ J ~ ~ JUN 1 6 14~gnefure~ {H'eese sae reverse aido for edditiona! common lJl - - P,~W HANOVER CO, • . ~ ~ N~''W 6aAN~1f~'R ~OU1vTY ROARS 01~ CC?IY1IYI~SSld~IV~f,'S 3~0 t'hestntrt ~t`reet, Room 30b . Wilmington, Nr .28401-093 s Te%phane (91(11 34 7-714.5 • FAX (9701 3d1-4130 ~f~P~oation far Appointment to Boards, ~ommitt&es, antl~Cr3miitissions` ~ • A~opointed by Zhe New Nenaver Caunt~ Board of Commissioners. Request far Apioaintr~ent ta: Name: . ' ~ ~. Home Address: ~SG l ~~ ~ j ~ ~ Now /onD have you been a resident oflYew Hanover County? _~~ ~ Mailing Address i s~'~' • `~ ~ t _~ !' (( - Cityand State E i~ i(J~ ~~j'`}~~~` ~ C Zip Gode: t ' Telephone: ; Nom: ~~ ~ '~ ~ ~ ~j Business: ~~~ -- ~q~ 7 i 'Sex: j'1(~~ ~ 'Race- CAzUClkS1~t~ "AAe: •7Xia iaf~rrr~atr~ is regclastsd for the s0/e parpoae of assvrarrg that a cro.xvtisaeteerr of the eonurra.~iry ~g appq/ni~ •"Employed b~: _ ~ ~14t~(riT~ ApIr.3~7t7rut nUyer»p/0ysdbyttreagsncyardepsruriontfarw/rrhthcsappGcaUonrsmsdt,mustresignhis/herposiQa»with New FIa.#over C~unfy upon appvinpnegt~ %/1 oCLVtifancr with Artrcly Y/, Sar. 4 of the I'/ow KatMrer Cocmfy Persasme/f'o/icy: .lab T;t~e: IC -~FN ~--~ As~_ ~~# {SST-~~ r Prflfessiona/ ACtiviti~5: S ~~ ~~~ ~,~~~ Vo/linteerActrKities: f ~~~.~- ~~ ~~"~ ~ ~~~.~~Q ~'~~V i f7" rJt~s j-Gi'e1 r . r- ~~ :- ~ , J-~ Wh y do you wr~h fo ~erve on the Board, Committee, or Canurrissian toques-tad? ~~`- i What do you foe/ ere your quohficai~ans far serving on the Badrd, Cammit#ec, or Commss;an toques#cd? .i i What areas of ~onCe~n would you I,1ce to see the 3aard, Committee, or CommiSSiRn address? i Are you currently serving on another board or committee appointed by a municfva/iry or ~ county? if so. please list: ~~ _T_ Date: ~ Signature{~ ~1-~ (FYeus• w~ town s;d~r ddi io f rfdl COmmert lJf ~ ~ G3~~~Or~7~D 7 ~~ JAN 3 0 iiii 1 r;~ ;v Nn~~OVEr~ CO. ;- . - r;.~~~~QS _ ~~~ ~ v g TOTAL P. 62 -. ~ .: NSW H~41ti/OV~~i CC~UIVTY ,BOARI] ~F COM'lV11S~lOlV~'RS. 32Q Cl~~stnut Street, Room ~D5 WilmfnQtan, ~1VG ~8~09-4D93 T$lsphcne l81 PJ 34 f-7149 FAX x9 101 34 1-4 f 34 - ~~c~~a~~ JUN Q Z ,ooh NEW HANOVER CO. App/tcatlon 1•pr AppoMtment to Boards, Corr~mtttecs; ~ -and Commisslcins Appolnied by the New Nanavef CAUnty gut+rd of G`vmr»lssloncrs. ; ,- Request fpr i4ppolr?~ment to: ,~r4•frrUp.t/L - ~,~31i.~'~ . _ . Name' ,~~~~ ~ ~ ,~i"~C/°r~~..~ _ . l~ume . - . - - .... ,,Now lonp 1,~vo yot! kBRr) ~ Addiass; ,~ ~~ ~'~ ,~?~9' /Ll',~/,~ C~d,r~ .dam- resfdor~t of New Henav~r Cnt~ntyt : - ~ y ++ .~ Mailing AddrQSS: ~d ~"''L ' Cit y and Sttrte: t~~1 ~ 6~~,4iG r o.~.~ ~/'~- . Zip,Code; ~~~c~~' . ~„ ,. ,. , Te/ephonQ: Norrte: ~^~~cp ~f'-t 9~'7~ ~ Buslnt3ss: ~~_.~~' ~- 'IGG? "Sax: _ /~'L _ "Race; C "Ape; ~~ 3 •Thlr information Js requsFteo'far tha sale purpose afsssvrlnp that a arosssectlon oI the community is eppointod. « "Emplo yad b y: .. - ~ ~r ~' ,f -- .. ~ •~ ` ~ 1r~5~i l-o.~.cryri~tfv .. ~"a•, "•A parson cutren7lyemploynd bythe epancyor depatimantfor which th;Rapp/lcation Is trade, trust rsslpn hisJhsrpos/tion with - "~:'J New Henovet Counfy upon appointment, Jn eccordorace with Article Vl, sec. 4 of the New Hanover county Person»e/Pulley, Job 71tle: •~ ,~~.~~' . Prolessionai At;ilvltles: VolunteerActivlNes: ,~Q~y ~'r.~v ~ ,~,. ac/ ~ ~ °'~~ , C~¢..t,rsr~ ~ ~,~~-~ Why do you wish to serve nn the Board, eommtttee, or Commission retiusst~d? ~ ' ~'' . tlG~ y~ ~ c3`~~"~9d ~~- r,~~tJ f ,r. r~,s i /~y ~GJ ~IJdr/7~~'.~/~. ®ij~ iy, Whet~do you tee! ara your qualifications for ssrvlnq on the 9nerd, Committee, or Cammiss/on requested? _____ _ C.~ p /t~C't+K /tms~ C i~f ~,~ ~ ~ ~f /y ssr~r'~~,rl~ s~.j' ,~s~'~t/,-vs ~ ¢, ~ What areas o1 concern waUld you like to see the Board, Comrnlttee, or Commissron address? Are you currently serving an another board or commftiee appointed 6y e muntc,'pality or a county? It` so, please i/st: D 128// fPl~era use roverae aldo for additions! rommantsJ . - REFERENCE S - '- Please provide three lo ca/personal references: . _ - .~ Name ~ ~ ~ - ~ Phone Number , . ~ :. . ~ P ~6~-a .: : . , - ;. ' _ ~~ G~~1- /~'d ~ icy ~, ~/~ ^ . . i~°?`d~2 _ _ - ~ f . ~ ry. ' ~v , !~ ~ ~d[J.v~tJy . .~ o~'. - - . y ~ •~ JJ II ~ I Ctt~ ... . ~ - . p . , .129 NF"W HAND VFR COUNTY BOARD OF COMN1/SS/ONFRS 320 Chestnut.,Street, Room 305 Wilmington, NC 28401-4093 Telephone (9 1 01 34 1-7 149 FAX (9.101 34 1-4 130 App/ication for Appointment to Boards,. Committees, and Commissions Appointed by the New Hanover County Board of Commissioners. Request forAppointri~ent to: /V~'W ~c~«j~/oVE/? GOUNT"Y •~L_t11~l4VlIlJ~ Gp/~Yj~JSS/O~ Name:_ f~0/3rcR~ ~~~GYIJICLIN ~F{ . tl/2, '.~1/-~ ~ • Home -- How.long have you been a - Address: /3c~ ~.~C' EW~T-E ~. C.L.UL~ R,~. ~ ~ ~ - ,,. / resident-of New Hanover Countyh /3 ~~.Q1~5 Mailing Address: / 9'00.. ~,c~s7-h /~ t> T~~1~ X17 ~ 15 W l ~1'» )1~ 7-p, ~ zg~to3 City and State: Telephone: Home: 9/0 ~o ~ . ~5~3 , ~ . _: Zip Code: Business: 9/0 25~ ~9l ~ 'Sex: _ J'I'I1I_.~._ 'Race: C4lJCC15/Q /J 'Age:'~ 3~0 'This in/armetion is requested Jor the so% purpose, o/assuring thel ecrass-section o/ the community is eppoinied. ..Employed by ~'>'7 /'1-f-l C~~ E ~ Az'C~-T !'T-.~ GTS "A person current/y emplo yed b y the agency or department for which this app/ication is made, must resign his/her position with New Hanover County upon appointment, in accordance with Artic% V/,' `Sec. 4 of the New Hanover County Personnel Po/icy. Job Tit/e: P/c /I~JC/Pfd L SE c_~7-y'LC-- S , Piofessiona/Activities: C r T'Y~Go(] art-" y G a rr7 p lZ C ~ ~ Jy 5 J VC- TaLC~~ ~II~t / ~ ~ ~LIf3 Cam/n rfj'C- 1J4rV0 USE 7",C151C 1/ aRCF ~ S?~.E.E'~N~ Gomm ~~.~ !-4f~ldJ US C- VolunteerActivities: •- ~- ~~ ~ F~ CE Why do you wish to serve on the Board, Committee, or Commission requested77a f}/'PG `/ ry/~ pp 6 Fuss/ d/~_ G-X1~E /?l E 1~I C E- ~h1 rD ,~/lI6 h>L-& m c~ ~ , ! N .n J2~.~1 S o N.p ~ ~.~ ,NV,b c6 rY~ /YJ pN ~ lV sZ ~"o V - / ~ ,~gs t/E~ G .4 s ?- ~-u« / ~ ~ Y 5~= N S~• ol= ~ U1~j a ~U,BL ~~ ~E R lG~ t -- La ~ ,4 r-~l7'"7' Eel ~ 77~E~ COUeU7-`/. LVhat do you feel are your qua/ifications for serving on the Board, Committee, or Commission requested? n/G~CJ vair,-, y .n/Vtn What areas of concern wou/d you like to see the Board, Committee, or Commission address7~JCFS-~~UG /!'PLC I7'J~/V7-,4T~6/ll ~(_ C/7'Y/CoU/LTrY GD7~'J~I?Eit1EN~`/VE PL1~1V_ Are yoA/u currently serving on another board or committee appointed by a municipality or a countyl If so, please list: IVY Date: / (Please use reverse r of edditiana/ comments~~~ .. ~''1 r-: ^ ~: ;,~ ~t~ CO. ,~:. ri? ,......, _ .~Cj'rLhJ Signature ~~~-----~ ~ ___~/ (OVER .. `~ ~~ , ~~~ ' . NEW HANOVER COUNTY • ~~\~~~~~~. ~~ ~ . BOARD~;OF COMMISSIONERS \q~a ~~~` - ~ • ' 320 Chestnut Street, Room 305 _ - ~;, `~~~...;, .. ,~ . Wilmington, NC 28401-4093 ,'. ~ ~.. .. r, • Telephone (910) 341-7149 .. . FAX (910) 341-4130 ~ ~ . • • Application for Appointment to Boards, Committees, and Commissions ~ • .. : LL` ~ Appointed by the New Hanover County Board of Commissioners: • Request for Appointment io: ° New Hanover County Planninu Board ' , .:. . ' Name: James B. Taylor - ~ ., ~.,:. .. ' "' 'How long have you been a'r.'esident of New Hanover County? 24 years , ' ; .. • - Home:Address: 4,10 Bedford Road East ~ ~ • • ~ ~ ` • . ,. 'Mailing Address: 410 Bedford Road East ~ ' .. .,, _ . City and State; Wilmington, NC Zip Code: 28411 ' `Teleph'one: Homed 6$6-7060" Business; 686-7060 or 540-2380 ~. *Sex; Male ~ *Race: Caucasian *Age: 57 's information is requested for the sole purpose of assuring that across-section of the community is appointed. • ~. . *Employed by: Self-etn~loved x **!A person currently employed by the agency or department for which this application is made, must resign his/her position with New. Hanover County upon appointment, in accordance with. Article VI, Sec. 4 of the New Hanover .County Personnel Policy. ' Job_Title; Owner - Community Planning Associates ,Professional A'ctivities;_none at present Vohinteer Activities: Bov Scouts of America. .Why do you wish to serve on the Board, Committee, or Commission requested? I have ]i~~ed and ~i orked in New Hanover County for 24 years of my life It's time to give something back to the community I live in ' What do you feel are your qualifications forserJirig on the Board, Committee, or Commission requested? ~ - 1 am retired from service with the State of North Carolina as a planner with the Division of Convnunity Assistance Department of ' Commerce dunn which tune I rovided techinical assistance to small towns and counties that could not afford to em lov fi:ill-time Manners: My work consisted of tireuarint? Land use Plans (CAMA and otherwise) zoning_ordinances subdivision retulations and various • '.otherother plannrn~studies for adoption by those local govenunentsfoi• adoption by those local govenunents at areas of concern would-you like to• see the Board, Committee, or Commission address? , control of the ex losive owth in the County . b ,...~ This page intentionally left blank .:r ,, ~ ,.~ .~~ a~~. I 134 F~ P`. #~8tdfi~i~fitFYitViiJV 11 F~QV ~d3~i.~~ '~~°, ~~ }... yYI'~ 13~ . ~ • • , . ~ NEW HANOVER COUNTY 80ARD OF COMMISSIONERS • - -'. - - ~ ~ REQUEST FOR BOARD ACTION' • Meeting Date: 09/21/98 - . Water ~ Sewer item#: 3 Estimated Time: Page Number:. - . - Deparfinent: Water& Sewer District Presenter: Wyatt E. Blanchard • y Contact:.Wyatt E. Blanchard SUBJECT:. •- .- • Consideration of Sewer Service for Areas with Excessive Septic. Tank Failures , ` BRIEF SUMMARY: • • • Information was presented at an earlierCommissioners meeting concerning sewerservice to areas in the County which have complained of an unusual amount of septic tank problems. The Brookfield/Brierwood and Weaver Acres are two areas which staff was asked to provide information as to the amount of septic tank problems which have occurred in the past few years. - ~ Based on research of the Health Department records; the attached-memo was written to provide the requested information. As indicated, there have been numerous repairs.in both subdivisions. Also, attached are schematics indicating the location of the proposed areas of sewer construction and.the • estimated cost to provide the service. The cost would bea2,824,500 for Brookfeld/Brierwood and -. 51,065,600 for Weaver Acres, with funds coming from the. District. - . • - RECOMMENDED MOTION AND REQUESTED ACTIONS - ~ ...: Staff recommends that. the Commissioners consider accelerating the construction of Brookfield/Brierwood - and Weaver Acres sewer systems ahead of the planned schedule. • ' if construction is accelerated, it must be coordiriated iri conjunction with the expansion of the Northside wastewater freatment plant. F ,- ` . FUNDING SOURCES - - ATTACHMENTS: ' Attached memorandum ~ - • Location Maps -- . REVIEWED BY: • . . LEGAL: App-rove FINANCE: N/A BUDGET: N/A HUMAN RESOURCES: N/A - • . COUNTY MANAGER'S COMMENTS AND RECOMMENDATIONS: ` - Concur with the County Engineer and recommend accelerating the construction of-project as .noted above. °. COMMISSIONERS`:ACTIONS/COMMENTS• `` . ,. • " r~lr{ ~~III~~.~iIQ - - - . ~~MOVEn a s ... 137 • ~osraorv~o ® ~ ' . , HEARD C~ .~ •; bATE ~._......,.~~.~- j NEW HANOVER COUNTY INTER-OFFICE ~ME~YIO TO: Wyatt E. Blanchard, County Engineer .~ ~ . ~: FROM: Christine Q. Neai, Engineering Program Assistant '_ ,. ., ~. . .. ; , ; y ., . , -. ~ , After reviewing the Subdivision files, at the New Hanover County >/nvironmental Health .Office, on the,. Brookfield/Brierwood and Weaver' Acres Subdivisions we were able to :determinethe' following facts: ~ ~ ~ ~ - ~ ~ ~~ ~ ' `~ ``~ _ - ~ ,. - .. . . ~ Weaver Acres- , - ~ ,._: 1 Of the 64 permits on file for this;subdiyision, 47%`of them we're :obtained for eptic tank repafrs.~~~~ w 2) Of those repairs.63% occurred within the past 5 years. . ~ ~ ,~ 3) Some homes have had more than one (l) repair permit. -These repairs occurred within 2 to 5 years of each other. Brookfield/Brierwoo - 1) Of the l 18 permits on file for this subdivision, 65% of them were .' obtained for septic tank.'repairs. -~ 2) Of those repairs 64% occurred within the past 5 years.` ~~ .. 3) Some homes have had more than one. (1)~ repair permit. .These ~ .` repairs oc$;dwh,~~n;~2 t 5 years ,of each other. I think it is also impo"rtant _®~n~o e that the Environmental Health Office has ,~Eaware of the incre~ase~in°~pern~its for the Brookfield/Brierwood Subdivision JJ OO Cf ~~~tt~~'~c~~ ~~~N ;n4 >< ?_ ., ~_ ~~ O f r Y / ,, ~ TE', ~, ~`'.. -, -....~- ~ / ,; ~: O ~ ° ! j l mil, / o '=i ~ it i .. i _ _ ~ ~ '. -~ ' / ° - ^to i =1^tc ! ~ - ir' ' i ~ Icl-ici ,i r -~; ~1, I 'i f ~ 1= i=,= i= j= i j l r~~~`, ,j=i~ ,;- i r LOCATION MAP NOT-TO SCALE ~ i ,~, 1 ~ 1 ~; , ~ i ~.~ ~ . i ^~, i !=~: j t 1 a 1 ~.1~~i ; i ,\' ~ it I e i~ ~`~ ~ i C i i % ll` ;\ ~ ~ l + 1 / -.fit / ~ ~~ / ~~ In i '_~ i ~' ;t i ~ ~ ~ ~ , °; `' ~; .'-~;~ ~~~-'' NEL~ HANOVER COiCTNTY - _ t_ ~ ,- , , ~,_ 'r----__ -; ~---- ',.._; _, AREA. TO ~E ~ERVIC~D BY ~R.OOKF'I]ELD/~R.I.~R~V O OJT ~-1E~UE.R EXTEI~T~'I®IiT TO'E~I, ES'I'IhL~1TED COST OF THE PROJECT: --------$2, 824 , 500 TOTAL, ESTIhL~.TED COST PER SERVICE: ~9,s~5.s~ M.<1P-NOT-TO-SCALE JULY 7, 1998 ~~~`~~~1 ~~~ ,; ~.~ ~~` ~ \~ . .. .. _ . ~ ., ;r f r ~ . _. " . . ~ ~af~e r.a cf yf ~.~~or. • cr . i'I - i •'r 2 I futfK~~. ~ ~ . 'T. ~ ' I I ~ r c.If s ~ P - ~~ S ~ ~ ... [ff b . .. _ .~- ~. X70 ~~ ~~'i e \ ^ / ~O I D j '~, ~~ p I ~ ` J o ---~ ^ I..~ ~ 1 - ~ ~ ~. ;^ i t ~ ~ I ^ ~ , ~ ' r=- ~ -^ i ~ o j o ; ~ ~ .]LOCATION MAP ~- ~ I I I° I^ I U I I- I^ I j c ~ '~' . I I J ~_ I / ~ I~ ' ---~ I ^, ^ ._ j ~ I. I I I L I ! i ^ ^ c I ~^ I I ' I~ I ^- . f I ~~ ' ~ o ~+ a _ I I __ - - ^---~ ----- I II ~ _ 1 I I I - LI. ~ II. ~ ~ ~'~I © L' - i,l ~ I ~ i I ~ _:~IG _ ~ ^ i j ~ I I ^ ~~ ~ 1 I ' Ii i Q f I. a i _ I I J I I E ^ i. Ij I I 1 - ~~~ , 1 I I --,. ~ ~ j ~j L , ~ I ^ a j I I I -- ^ i I I i ~ I E I ^ ~ j I i I ~ I~~ I C' I r ~ I I. ^ i ^-~ i ~ I... I I I I 1. ~_ a ifI I I I I I ~ i i I . I i'I } I ~ I .L ~ r j. 'a I J j I a I j a I f I ! I ^ i ^ ,. I I I ~ j i ~ I ~JI- I I - li I i - i^~ ~ I I ~ t ~ ~ I u . L 16 I I. Ci I I I .~ .~ I I ~ I ~ ~ I ~ t 1 n 1 .„~ I I j_' -.I 1 ° ~ ' i I I ~ I-I~~ I~~., ~ ~. i i -- t I i _ _, _ .. C. _ -_ 'a I ~ i I i t I ~ i i._I I ~ I ' ~ ~ i' I i ~ I I -- _- ± I _ i f. , ~ ~ ~~ I - ~ . NEW. HANOVEI~, COUNTY- .: ~ - : 1~R.EA 7['O ~E SERVICED BY P]R.OI'OSED. ~TEAVER - ._ - ~ ACRES SE~ITER . EX~'EI~TSION ~ TO'1;4I, EST'I3f.4TED COST OF THE PRO,JEC"I~ ` ~ ~ ~ -- ---~1, 065, 600 ~ IOTA T. ESTIMATED COST PER SERVICE: . $9,266.09' MAP-NOT-TO~CALE JULY 7. 198 " CONSENT AGENDA NEW HANOVER COUNTY BOARD OF COMMISSIONERS SEPTEMBER 21, 1998 ITEMS OF BUSINESS 1. Approval of Minutes 2. Approval of Release of Value 3. Approval of New Hanover County and New Hanover County Fire District Collection Reports 4. Approval of award of Bid #99-0039 „and approval of contract #99-0039 for sulfuric acid for the WASTEC facility of the Environmental Management Department 5. Approval of Budget Amendment #99-0027 to rollover unexpended grant funds from FY 97-98 to FY 98-99 6. Approval of Resolution requesting to add Strata and Callie Streets to the State Highway System 7. Approval of Proclamation declaring Saturday, September 26, 1998 as • Hunting and Fishing Day in New Hanover County 8. Approval of Electronic Benefits Transfer -Customer Training at DSS • 143 PAGE NO. 145 147 149 153 179 185 189 193 ~~~., ~. +. 144. NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION ;~ Meeting Date: 09/21/98 - Consent Item #: 1 Estimated Time: Page Number. Department: Governing Sody Presenter: Lucie F. Harrell Contact: Lucie F. Harrell SUBJECT: - Minutes BRIEF SUMMARY: Approval of the following sets of minutes: Regular Meeting August 17, 1998 Joint City/County Meeting August 18, 1998 EMS Work Session June 11, 1998 Coastal Land Trust Work Session Sept. 3, 1998 Closed Session July 27, 1998 Closed Session Sept. 8, 1998 RECOMMENDED MOTION AND REQUESTED ACTIONS: Approve minutes ; FUNDING SOURCE: . ATTACHMENTS: ITEM DOES NOT REQU/RE REVIEW COUNTY MANAGER' COMMENTS AND RECOMMENDATIONS: Approve minute ~: COMMISSIONERS~ACTIONS/COMMENTS• COUNTY COMMISSIONS APPROVED C~J'• REJECTED O REMOVED O POSTPON_ ED Q HEARD Ca 145 ~. Tliis page intentionally left blank ' .- 1~6@~bl~M~~ ~TfiiUC4~ O CI3T~s+~Si ® ~1lp~f;~~ ~ Q~A~N ~~ ~g~~ ~4s ~ .• . - NEW HANOVER COUNTY BOARD OF COMMISSIONERS . ~ - REQUEST FOR BOARD ACTION Meeting Date: 09/211 98 Corisent Item #: 2 Estimated Time: Page Number: - ' Department; TAX Presenter: None Required •. Contact: Roland Register. ' ~, ... -SUBJECT: ' - • :. , . + Release of Value .. ,. -.~ • BRIE' SUMMARY: ~ , • ~ - - . ' . Request release of the following -late listing penalties as the taxpay - er certified they. mailed. their listing on time: APAC Carolina, Inc. $ 1,881.26 - C V Specialists, Inc. -4.90 - ' Hanover Regional Animal Hospital, Inc. `40.18 Hotel"Group, Inc. (The) 978.86 McPhersons Body'Shop ~ 5:12 - ~" - ~ ~ Merritt, Alvin, K. DBA Merritt's House of BBQ 8.47 • .Michaels Auto 'Sales, In.c. • 7.97 R. J. Ga(phin & Associates 13.12 • Tom 0. Quinn Rigging Service ~ 36.13. ~ - , RECOMMENDED MOTION AND REQUESTED ACTIONS: ,.. . ... ... Recommend approval of these releases. ' ° - ~.` • FUNDING SOURCE: • - . ' . _ ATTACHMENTS: ITEM DOES NOT REQUIRE REVIEW COUNTI! MANAGER'S COMMENTS AND RECOMMENDATIONS: ` Coricurwith Tax Administrator. .COMMISSIONERS' ACTIONS/ OMMENTS• ~®UN~ C~MMI QNr. ~ ARPROVED . . ~ REJECTED Q{ .. .. - REMOVED 4 . 4'QSTPt~NED ~ _ ~ . . ,, .. B3Ai`E .~wwwrwrwr~~~ • - •, - 147_ r... ~:. ~: NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION ~~ - Meeting Date: 09/21/98. r . Consent Item #: 3 Estimated Time: Page Number: ~ ; `Department: TAX Presenter: None Required Contact: Patricia Raynor SUBJECT: ,- New Hanover County and New Hanover CountyFire,District Collection Reports ':. BRIEF SUMMARY: Collection reports as of August 31, 1998. RECOMMENDED MOTION AND REQUESTED ACTIONS: FUNDING SOURCE: ATTACHMENTS: t ITEM DOES NOT REQUIRE REVIEW .. ... _.. COUNTY MANAGER'S COMMENTS AND RECOMMENDATIONS: .Recommend acceptance of report. COMMISSIONERS' ACTIONS/COMMENTS: ~p1~NTY COMMtSStON- f~ ~.; ~~, r tD F ~~~,r ~VED O PCSTPONED HEARD ~, ,... DATA ~e _ . ~. ~~ 149 ` ,_ ~ .° NEN HANOVER COUtr'TY TAXI COLL:EGTIONS CCLLECTIOIrS Tt;RU 08/31/98 CURRENT TAX YEAR -.1998 AD VALOREM ORIGINAL TAX LEVY PER SCROLL # 60~35b~678.07 DISCOVERIES ACDEO ~ •>`316~025.9L~ LESS ABATENEfYTS 18~103.92- TOTAL TAXES CHARGED # 60~654~600.11 ADVERTISING FEES CHARGED .00 LISTING PENALTIES CHARGED 50488.31 TOTAL LEVY ~ # 60~705~088.42 COLLECTIONS TO DATE -.. 2387612.70-. OUTSTAfvDING BALANCE $ bC~46b~475.72 PERCENTAGE C~LLECTI=D .39°~* BACK TAXES G~ONSENT AGENDA DATE=--------- :. ITEM ND. `•.- ROTOR VEHICLE Sr .1~828~077.80 .~~a ~ ~` : 4 ~ 7 9 3.2 ~8 .12~245.9.1- #~y 1~82O~b25.17 ,~~~.t~x~~,~. ,~~. .. ~-~~-~~` •.00 .CC S I~820~625.17 :~-°:' ':aw~_01:7 ~ 605.64-. # 'E 03~~C19.53 55.89°~~ ~{ ~ ~ . REAL ESTATE AND PERSONAL PROPERTY # 2~800~390,39 CHARGES AGt;EG I1~333.44 ~ ' LESS ABATEMENTS 9~63~.87- . .~ TOTAL TAX'ES' DUt' .:.'. ' ' $; 2~'802'~~08846 COLIECT IOtVS TO`'°DATt _ -----391081.12- ,' OUTSTANDLNG aALANCE #:<.'2~411~a07.3.4 -~ PERCENTAGE COLLECTED 13.9b ~ , ROOf? OCCUPANCY 7AX CCLLEC7ICfti'S PRIVILEGE LICENSE COLLECTIONS ~MS COLLECTIONS AUG,1998~. 392~306.7C 4192.00 .00 F.ISCAC 'YTD~: ' '693774:22 ~12~194.50 .00 TOTAL MONEY PROCESSED THRU COLLECT.iON O=FILE FOR NEW HANOVER COUNTY CITY OF kILMINGTON ~;RIGNTSVILLE 3cACF~~ CARCLIf~A $EACH AhC KURE 3EACH 70 DATE - ~~~9~90~bbp9.08. d t '~~~;~l.~Frt~kr THIS REPORT IS FOR FISCAL. Y%EA~R~ ~37E,G~I~NNING JULY 1~ .1998. R CTFULLY SUaMITTEO~ ~ ~-''• " ~ ""~".~$ Ll ~'-1 c i s.. ~lcy ~ a ~ ~ ~ ~, . ~.~ . ~- -, PATRICIA J. OR ~¢~.~~~,~~ COLLECTER CF REVENUE ~ ~~~~~ ., ~~~ ~~ '~ COMaINED COLLECTION PERCENTAGE - 2.01 r,' ~~ ' CONSENT AGENDA DATE=--------- .., ITEM NG.------ ~. . i NEW HANOVER COUNTY FIRE DISTRICT TAX COLLECTIONS ~ I COLLECTIONS THRU 08/31/98 CURRENT TAX .YEAR - 1998 AD VALOREM ORIGINAL TAX LEVY PER SCRGLt E 1~"337298.50 DISCOVERIES ADDED ~ 6997.66 LESS ABATEMENTS 73.08- TOTAL TAXES CHARGED S 1~344~223.08 LISTING PENALTIES CHARGED 1200.61 TOTAL LEVY $ 1~345~423.69 COLLECTIONS TO DATE 6~058.29- OUTSTANDING BALANCE $ 1~339~365.40 PERCENTAGE COLLECTED .45°~~ 3,ACK TAXES REAL ESTATE AND PERSDNAL PROPERTY $ 53053.09 CHARGES ADDEC 180.32 LESS ABATEMENTS 197.41- OTAL TAXES DUE. ~ ~ $-..~ 5 3036.00 COLLECTIONS TO DATE . _ _-- .8364.56=: OUTSTANDING BALANCE ~'`~ '""4"4~b71.04 PERCENTAGE COLLECTED 15.771 THIS REPORT IS FOR FISCAL YEAR BEG INNING JULY 1~ 1998. ECTFULLY SUBNITT FDA /~ /. Cam- ~ C l N ~• ~~"~-~ B U T ~ PATRICIA J. ~A'YNOR COLLECTOR OF REVENUE COMBINED COLLECTIDN PERCENTAGE - 2.21 MOTOR...VEHICLE. ~~ 42 ~~34~3:'59 120.41.. ,298.64-. #----- 4 2 ~ 165': 3 E ~----^42 ~ 165:36 .. 2 4 ~ 6 2 9.2,7- 3 ,-17537:09 58.41# ..3 ~. 151 152 ~. ~, .. ~:. NEW HANOVER COUNTY BOARD OF COMMISSIONERS . REQUEST FOR BOARD ACTION . . , Meeting Date: 09/21/98 +` ~ Consent Item. #: 4 _ Estimated Time: Page Number.- Department: €nvironmental Management Presenter: • ..: Contact: Amy Akin , . . ..,• ,SUBJECT: Award of~Bid # 99-0039 and approval of Contract # 99-0039 for sulfuric acid for the'WASTEC Facility of the Environmental Management Department. BRIEF SUMMARY: • Two bids were received in response to a formal bid for the purchase of sulfuric acid for the WASTEC .- Facility, Staff has reviewed the two bids received and is recommending award to the lowest bidder, ` ~ P~ill,aman Chemical Corporation of Suffolk, Virginia, at the unit price of $.88 per gallon for the first year and $.93 per gallon for the second year. Estimated usage for two•years is $21,720.00. ~ - , RECOMMENDED MOTION AND REQUESTED ACTIONS: Staff recommends adoption of the attached resolution awarding Bid `# 99-0039 for sulfuric acid""for the WASTEC Facility to Prillaman Chemical Corporation at the unit,price of $.88 per gallon for the firsf year of ,fhe contract and $.93 per gallon for the second year and approving the contract: `~ ' ~ .' . ' F1INDING SOURCE: -. , ..Funds have been appropriated in account # 70D-485-4194-4230=23 - ,ATTACHMENTS: ". .' ` As part of this transmittal, the resolution is being sent as-sn attachment.. ' `99-0039r.wp '' ~ .. .. . ,. - `REVIEWED BY:~ _ ... . LEGAL: Approve FINANCE:-Approve BUDGET: Approve HUMAN RESOURCES: N/A= ' . COUNTY MANAGER'S COMMENTS ND RECOMMENDATIONS: - - Recommend adoption of resolutio d thorize chairman to sign contract.. A copy of contract is on file ``~ in the County Manager's offs COMMISSIONERS' ACTIONS/C MMENTS: • . COUNTY £OMMISSDQ3~~i , . aPPROV~o ~ . ~>MOV- o ~~'t~Nl- ~.: -.. . ,. .. ~m , . .. /~ QATE ,~g»+,~' . - 1~3 . - ~ , - .RESOLUTION . ~ OF THE .BOARD OF CONIlVIISSIONERS ~~~°°°"' OF ~ - . NEW HANOVER COUNTY WHEREAS, after due advertisement, bids were received and publicly'~opened by the Finance Department at 3:00 p.m., on the 1st day of September, 1998, at the County Administration Building, 320 Chestnut Street, Wilmington, North Carolina, and the following bids were received for sulfuric acid for the WASTEC Facility of the Environmental Management Department, Bid # 99-0039: Two Year First Year Second Year Estimated Expenditure .. ~ _ _ , PrillamanChemical Corp. ,$.88/gallon $..93/gallon ~ ..$21,720.00 4 Koch Sulfur Products Co. ~ "$.91/gallon ~ - ~$91%gallon;, $21,84000 .' 1 - ~ , .. ,; , ry AND WHEREAS; :the Environmental Management Director, the Finance} Dir ector, and the Coun Ivlanaaer recommend that the~contract tie awarded to'Prillaman Chemical Corporation of Suffolk, Virginia, the lowest responsible bidder, in the~amount'of $.88 per gallori for the first year and $.93 per gallon for the second year, estimate of two year usage in the amount of Twenty-one.-Thousand Seven Hundred Twenty Dollars.($21,720.00); -, ~ .. ;. _ ,. .. ,,. .. .. . . _~_ AND WHEREAS, funds have been previously appropriated and are now in Account ~No. 700-485-4194-4230-23 to cover this contract;- ~ ~- NOW, THEREFORE, BE IT RESOLVED by the Board of County Commissioners of New Hanover County that the contract for sulfuric acid for the WASTEC Facility of the Environmental Management Department, Bid # 99-0039 be awarded to Prillaman Chemical Corporation in the amount of $.88 per gallon for the first year and $.93 per gallon for the second year, estimate of two year usage in the amount of Twenty-one Thousand Seven Hundred Twenty Dollars. ($21,720.00);- and that the County is hereby authorized acid directed to execute the contract, contract' form to be~approved by the County Attorney. This 21st~day_of September, 1998: (SEAL) ~,~flii~~l~~d9~ U~3 ~~ ®t~ ~~'~~L~R ATTEST: ~~ ~~~ 9~. Chairman, Board of County Commissioners _ ; .DRAFT New Hanover County Contract # 99 - 0039. ~- ~ - , . ., NORTH CAROLINA : -AGREEMENT NEW HANOVER'COUNTY i ~ _ THIS CONTRACT,. made. and entered into -this day of 1998; by and between NEW ~ HANOVER COUNTY, a - ., , ' ~ , political subdivision of_the State of North Carolina, hereinafter referred to as "County';. and PRILLAMAN CHEMICAL CORPORATION, a foreign corporation, organized under - -the laws of the State of Virginia, hereinafter referred to as "Vendor". 1 WfTNESSETH: WHEREAS, County advertised for bids for sulfuric acid for the WASTEC ~~~ .Facility of the Environmental Management Department, Bid # 99-0039, and bids were received and opened, as required by law; and' . ~ ~ :WHEREAS after careful. consideration of the bid proposal submitted by .. _. ,_ Vendor; the Board of Commissioners of New Hanover County has adopted a resolution ~. authorizing ttie acceptance of such bid proposal and-the execution of a contract with . Vendor covering the purchase and delivery of sulfuric acid, according to Vendor's Bid F . ~ ~. .. . Proposal. _ ~ .. ' - NOW, THEREFORE, in consideration of the mutual benefits inuring to the parties .hereto, said parties covenant and agree as follows: ~. - ~ . 1: Exhibits to Contract: The-Bid Package, which,. includes County's `; Technical Specifications, Invitation to Bid and Instructions to Bidders, marked Exhibit A; >. and Vendor's Bid Proposal, marked Exhibit B; are attached hereto and made a part. of . `this contract as though fully written herein. 2: Term. This contract shall commence on November 12, 1998,. and shall continue until November 11, 2000. . - ~ ; 1 . ~ ~ 1.55- ,ti ~ 3. -Risk of Loss. Risk of loss to County for the goods purchased shall remain with Vendor until the goods are delivered to County F. O: B. WASTEC facility, New Hanover County Environmental Management, Wilmington; North Carolina. ' ~ ~~~ 4. Delivery. Vendor shall deliver all goods ,purchased by County within three. (3) consecutive.calendar days after receipt of order: ,~ `5.~ ~ Payment: Payment for suifuric~acid shall be made within thirty (30) days after~receipt of goods, their acceptance~by County and receiptu'of~iiivoice: County will be. invoiced based on quantities' delivered and determined by certified scale weighing at the point of landing, unless provem to be in error. ~ - ~ ~ - 6. Indemnity. Vendor shall indemnify and hold New Hanover County, its agents .and employees; harmless against any. and` all claims, demands, causes of action, or other liability, including attorney fees; on account of 'persona! injuries or death or on account of property damages arising out of or relating to the work`-to ~be performed by Vendor hereunder, resulting from ithe negligence' of`or the willful act or _. omission of Vendor, his agents,employees and subcontractors. - . ~. ~ ,. 7. 'Insurance. Vendor shall mainfain insurance from companies licensed to;wirrite business :in North Carolina and acceptable to New Hanover-County, of the kinds and minimum .amounts specified below. - .. _ ::°8.-Certificates and Notice of Cancellation. Before commencing work under this contract, Vendor shall furnish County "with certificates of ally insurance required below. ~ Certificates '"shall indicate the-type; amount, class of operations covered, effective date and' expiration ~ date- ofr all policies, and shal'I contain` the following statement: ~ - ~ ~ ~ ~" ~ ~ ~ ~ - "The insurance covered by this'~certificate will~~ riot be canceled or materially altered, except. after thirty (30)_ days .- written notice has been received by~County": 9. Workers Compensation and Employers Liatiiiity Insurance. ~ ~ ~~ 1~s 2. Covering all of the Vendor's employees to 6e engaged.in the work under this contract, , ~~ .providing the .required statutory benefts under North Carolina Workers Compensation Law, and employers liability insurance providing limits at least in the amount of ` ~ $100,000/500,000/100,000: applicable to claims due to bodily injury by accident or` `~ disease. 10. Commercial General Liability. Including coverage~for independent - contractor operations, contractual liability assumed under the provisions of this - contract, products/completed operations liability and broad form property damage liability insurance coverage. Exclusions applicable to explosion, collapse and ~ ~, . ~ underground haza"rds are to be deleted when the work involves these exposures. ,The ` policy shall provide liability limits.at least in the amount of $1,000,000 per occurrence, - combined single limits, applicable to claims due to bodily injury and/oc property' ` . .damage. `New Hanover County shall be named as ari additional insured under this . policy, ... ~ ~ . . ~ 11. ~ Automobile Liability Insurance. Covering all owned, non=owned - " and,hired.vehicles, providing liability limits at least in-the amount of $1,000,000 per ` occurrence combined single limits applicable to claims.due to bodily injury and/or property.damage. . " 12. Termination. .. ,. . ~~ .12.1 Default. If Vendor materially breaches."any one of the terms or ,` . condition contained in this contract, County may terminate this contract fprthwith.~ Upon termination,.. County.may, without prejudice to an action for damages or any other. .'remedy; enter into. another contract for the completion of this contract. County may, deduct-all costs of completing the contract from any monies due or which may become due to Vendor. ~ . . ", .12.2 Non-appropriation. All funds for payment. by the County under :. ~ ,: , . . . 3 . _ 1 ~~7. this contract are subject .to the availability of any ann"ual appropriation for this purpose by the Board. of Commissioners.. (n. the. event of non-appropriation of funds' by the Board of Commissioners for the'services provided under the contract, ~ttie County will terminate thecontract; without termination charge or"liability, on the'last day of`the then-current fiscal year or when the appropriation made for then-current year for the services/items. covered by this contract:is spent, ~whiehever_ occurs first. If at any time funds are•not appropriated for the continuance of this contract; cancellation shall be accepted by the Vendor on thirty (30) days'~prior written notice, but~failure to give°such notice shall be of no effect and the County shall not be~ obligatedunder this Conti-act beyond:the date. of ermination: _ a ~~ _ 12.3.~~ This agreement maybe terminated without cause'byeither party with thirty (30)~ days written notice to the other party. ~~ . ~ ~ ::13: Non-Waiver of Rights; It`is~agreed that County's failure to insist upon the. strict performance of any provision of this contract or_ to exercise any right ' ~ : _; based upon a breach thereof, or the acceptance' of any performance duping such breach; shall hot constitute a waiveraof any rights under this contract. ~ ~ ~'' ~` ~ ~ ' . . ~ ~ 14~. Subcontractors.' Vendor sha[I be fully responsible~for~all ~ ~ ' negligent acts and omissions of his or her subcontractors and of persons-and ~ ~. organizations employed by them to the same extent that Vendor would be responsible for these acts and omissions.°Nothing iri'the 'contract documents shall create any contractual relationship between County andany `subcontractor or other pe'rson'or organization having a direct~cont~act with Vendor; nor shall it create 'any obligation on the part of County'to pay any money due any such subcontractor or other person or ' organization, except as may otherwise be required by law. 15. Assignment. The parties mutually agree that this contract is~not assignable and,shaPl not be assigned by either party without the written°consent of the ~'~~ 4 other party and the surety to this contract. 16. Non-Discrimination. Vendor will take affirmative action not to discriminate against any employee or applicant for employment or otherwise illegally deny any.person participation in or the benefits of the project which is the subject of this _ contract because of age, race, creed, color, sex, age, disability or national origin. To . ~ the extent applicable,. Vendor will comply with all provisions of Executive Order No. 11246, the Civil Rights Acts of 1964 (P. L. 88-352) and 1968 (P.L. 90-284), and all applicable Federal, State and local laws, ordinances, rules, regulations, orders, instructions, designations and other directives promulgated to prohibit discriminations. Violation of this provision, after notice, shall be a material breach of this agreement and may result, at County's option, in a termination or suspension of this agreement in whole or in part. 17. Familiarity with Laws. The Vendor specifically acknowledges that he has made himself familiar with all Federal, State and local laws, ordinances, rules . _ .and regulations, includin all Federal and State Occu ational Sa ~ ~ ~~ 9 p fety and Health Act (OSHA) requirements, which may in any manner affect those engaged or employed in the work of the project, or the materials or equipment in or about such work, or in any way affect the conduct of such work and agrees that he, his employees, subcontractors and suppliers will, at all times, comply with same. if the Vendor shall discover any provisions in the Contract Documents which are contrary to or inconsistent with any such law ordinance, rule or regulation, he shall immediately give notice thereof to the County in writing, identifying any items of work affected, and he shall not proceed until he has received written direction from the County with respect to these items. If the Vendor performs contrary to or inconsistently with any such law ordinance rule or regulation without giving such notice, he shall bear all costs which area consequence of such performance. . 5 1~~9 18. Notices. All notices required hereunder to be sent to either party shall be sent to_the following. designated addresses, or to~ such other address or addresses as may hereafter be designated by,either party by mailing of written notice of such .change of address, by Registered Mail, Return Receipt Requested: To County: . ,New Hanover County Environmental Management Attn: Ray Church, Director 3002 Highway 421 North. Wilmington,~NC 28401 To Vendor: Prillaman Chemical Corporation Attention: Kevin Kilmartin, Municipal Sales Manager P.O. Box 1606 Suffold, VA 23439-1606 19. Independent Contractor. It is mutually understood and agreed that Contractor is an independent contractor and not an agent of County, and as such, ~_ .. `:::Contractor,. his or her agents and .employees shall not, be entitled to. any. County employment benefits, such as, but not limited to, vacation, sick leave, insurance, worker's compensation, or pension or retirement benefits. 20. interpretation. All of the terms and conditions contained in the _ . ~~ contract documents shall be interpreted in accordance with the laws of the State of North Carolina. 21. ~ Entire Understandin~g. This contract constitutes the entire understanding, of the parties and contains -all of the terms agreed upon with respect to the subject.. matter hereof. No modification or rescission of this contract shall be effective unless evidenced b a si ~ned writin Y g 9~ IN WITNESS WHEREOF, the parties have caused the execution of this instrument, by authority duly given on the day and year first above written. 160 6 ~ [SEAL] NEW HANOVER COUNTY William Caster, Chairman Board of Commissioners ATTEST: Clerk to the Board [CORPORATE SEAL] ATTEST: President Secretary ' - This instrument has been pre- audited in the manner required by the Local Government Budget .: - - and Fiscal Control Act. Approved as to form: County Finance Director ~ County Attorney NORTH CAROLINA - NEW HANOVER COUNTY I. a Notary Public of the State and County aforesaid, certify that Lucie F. Harrell personally came before me this day and acknowledged that she is Clerk to the Board of County Commissioners of .New Hanover, County, and that by authority duly given and as the act of the Board, the foregoing instrument was signed in its name by its Chairman, sealed with its official seal and attested by herself as its Clerk. WITNESS my.hand and official seal, this day of 1998. My commission expires: • PRILLAMAN CHEMICAL CORPORATION 7' Notary Public 1~1 STATE OF COUNTY~OF I. a Notary Public of the State and County aforesaid, certify that personally came before me this day and acknowledged that (s)he is Secretary of PRILLAMAN CHEMICAL CORPORATION, a foreign corporation, organized under the laws of the State of Virginia, and that by authority duly given and as the act of the corporation, the foregoing instrument was signed in its name by its President, sealed with its official seal and attested by himself/herself as its Secretary. WITNESS my hand and official seal, this day of , 1998. Notary Public My commission expires: 1~2 g COUNTY OF NEW HANOVER, NORTH CAROLINA INVITATION TO BID ON SULFURIC ACID Pursuant to Section 14.3-129 of the General Statutes of North Carolina, sealed proposals addressed to Amy J. Akin, Purchasing Agent, New Hanover County Finance Office, 320 Chestnut Street, Room 602, Wilmington, North Carolina 28401 and marked "BID FOR SULFURIC, BID # 99-0039" will be accepted until 3:00 p.m. Tuesday, September 1, 1998. The bids will be publicly opened and read immediately following the latest time for receipt of bids in ` the New. Hanover County Administration Building, 320 Chestnut Street, Room 601, Wilmington, North Carolina. Instructions for submitting bids and complete specifications may be obtained at the County Finance Office during regular office. hours. The Board of County Commissioners of New Hanover County reserves the right to accept or reject any or all bids and to make the purchase which will be in the best interest of the County. Amy J. Akin ,.... . .._ ..~_.. ,:.. Purchasing Agent ._ .. _., New Hanover County Advertised`. August 16, 199.S • 163 INSTRUCTIONS TO BIDDERS NEW HANOVER COUNTY, NORTH CAROLINA BID # 99-0039 SULFURIC ACID New Hanover County Finance Office Attn: Amy Akin, Purchasing Agent 320 Chestnut Street, Room 602 - . : . Wilmington, NC 28401 ~- .. .. _ , Phone: (910) 341-7190 Schedule Advertisement August 16, 1998 , Deadline for Receipt of Proposals September 1, '1998 at 3:00 p.nr. New.Hanover county Finance Office 320 Chestnut Street, Room 602 ' Wilmington,'North Carolina 28401 (O~enrxg to beheld irr Roma GDI Cmrfereue•e Roonr) Award of Contract. SeptenrUer 21, 1998 Effective date. for begiruling of ne~v Norenrber I2, 1998 contract Preparation and Submission of Bid Proposal Completion of Bid Form: Bids must be on bid proposal form contained in this bid package; the original and one copy required. Submitted with the original proposal form and copy shall be a complete set of detailed specifications and manufacturer's warranty indicating compliance with these specifications. A]1 prices ai~d notations shall be written in ink or typed. Changes or corrections made on the Bid must be initialed by the individual signing the bid. No corrections will be permitted once bids have been opened. Requrred Specrficat~or~s: Bidder shall submit as part of his proposal a laboratory specification sheet and a material safety data sheet for the sulfuric acid the bidder proposes to furnish. Bidder's specifications shall be in strict accordance with the County's specifications. Any bid which is not in strict accordance with the County's specifications must list each exception separately in a letter submitted as an attachment to the Bid Proposal. Deviations: New Hanover County reserves the right to allow or disallow minor deviations 1~4 1-IDES ' / or.technicalities should the County deem into be to the best interest of the County. New ' Hanover Cour-t•y shall' be the sole judge of what into be considered a minor deviation or technicality. - ~ .. . Warranties: Bidder warrants that all goods furnished shall be free from all defects, and shall : conform in all respects to the technical specifications established by the County. Bidder shall ~ ' ,~. submit manufacturers' warranties against defects in materials and workmanship covering the • ; :~. ~ , goods bid upon. ~ r'. - ' If the County's specifications include a statement of the particular purpose for which the goods will be used, the goods offered by bidder shall be fit for this purpose: ~~ ~ ~ ,. Submission of Bid Proposal . ~ t ~ ~ ~ ` .. Bdsymust be in sealed erivelopes properly marked "BID FOR SULFURIC ACID, BID # 99=0039", and hall be addressed to .County at the.following address: • ' : ,~ , : - , New Hanover. County Finance Office < , . ' . Attn: Amy Akin, Purchasing Agent 320 Chestnut Street, Room 602. ~ - ., Wilmington, ITC 28401 ~ ' ~~ Condition of Goods All moods shall be new and m no case will used, reconditioned or obsolete parts'be accepted. Trade Secret Confidentiality ~ - All bid proposals received and recorded at-the bid opening are considered public record and available for public inspection. According General Statutes 132. - ] .2, trade secrets contained in a bid may be, ' kept confidential ifthe bidder; at the time the'bid is submitted, designates the secret and requests that . it be kept confidential. This right of privacy will be construed as narrowly as possible to protect the' . ~- interests ofthe vendor.while attempting to maximize the availability of information to the public. ' ~ ". .Time For Opening Bids - .. . Proposals will be opened promptly and read at the time and date set forth in the advertisement: Bidders or.t~heir authorized .agents are invited to be present. Any .bids received after the scheduled { ~ closing' time for •the receipt of bids will not be considered and' will be returned to the bidder,.. • '''unopened;, . i _. ~ . , d ~ ~• ` I-•2.of 5 . ~ ~ 1 ..~1 ~~ ,.' .~ --- ~ Withdrawal of~,Bids, >: _ ~ . , ., .~. , .t • . Bidders may withdraw or withdraw and resubmit their bid at any time prior to°the closing time for receipt of bids. But no bid may be withdrawn after the scheduled closing time for receipt of bids for ..._, .a period of sixty {60). days.• ~ ~ - .. -! ~ . •. Award of Contract , _, , ,., ~ ;. ~' The award of any contract resulting from this bid will be made to the lowest responsible bidder, .. ..•ta}cing into consideration,quality, performance~and time~specified in -the'prop'osal for the. performance of the contracts _ a a. Considerations in Award of Contract In determining the .lowest. responsible bid iri. accordance with G.S:` ' 143-T29 the Board of Commissioners will consider, among other factors: modern, accepted practices; engineering; design, ' efficiency and workmanship; maintenance costs; availability of service and parts inventory; and performance (based on County's previous use. of the, same~~or similar equipment made by the manufacturer). ~~ , , . Federal Taxes ~ ., .. New Hanover County is exempt from and will not pay Federal Excise Taxes or Transportation'Taxes. :: . - -_ . ~ - North.Carolina Sales Tax ,- _ ~ ~ . , ~ ~ , ~,; , If bidder is required to charge North Carolina sales tax on bidder's sales; ,bidder shall not include it as part of the bid price. County will pay North Carolina sales tax over and above bid prices when invoiced. ~ ~ ~ ~ . .. , , , Price ., .. ~ Bidder steal guarantee the prices quoted against any increase for whate`'er delivery' date is'specified and contract period required. ~~ ~,~ Place of Delivery _ .; ~.. Goods shall be delivered. F.,O.B. WASTEG Facility, New Hanover County 'Environmental Management, 3002 Highway 421 North, Wilmington, North Carolina and shall be~cornplete and ready for use unless otherwise specified. I-3 of 5 .~ Instruction in Use of Goods The. successful bidder shall be responsible for instructing County personnel in the proper use and maintenance of the goods. Responsibility of Compliance With Legal Requirements The bidder's products, service and facilities shall be in felt compliance with any and all applicable state, federal, local, environmental and safety laws, regulations, ordinances and standards or any standards adopted by nationally recognized testing facilities regardless of whether or not they are referred to in the bid documents. Indemnity Vendor shall indemnify and hold the County, its agents and employees, harmless against any and all claims, demands, causes of action, or other liability, including attorney fees, on .account of personal injuries or death or on account of property damages arising out of or relating to the work to be performed by Vendor hereunder, resulting from the negligence of or the willful act or omission of Vendor, his agents, employees and subcontractors. Insurance Vendor shall maintain insurance from companies licensed to write business in I~Torth Carolina and acceptable'to New Hanover Countyof the kinds and minimum amounts specified below. `. ' . Certificates and Notice of Cancellation Before commencing work under this agreement, Vendor shall furnish New Hanover County with certificates of all insurance required below. Certificates shall indicate the type, amount, class of operations covered, effective date and expiration date of all policies, and shall contain the following statement: "The insurance covered by this certificate will not be canceled or materially altered, except after (30) days written notice has been received by New Hanover County." Workers Compensation and Employers Liability Insurance Covering all of the Vendor's employees to be engaged in the work under this contract, providing the required statutory benefits under North Carolina Workers Compensation Law, and employers liability insurance providing limits at least in the amount of ~100,000/~00,000/100,000. applicable to claims due to bodily injury by accident or disease. • I-4 of 5 1~7 Commercial General Liability ~ - Including, coverage for. independent contractor operations;• contractual liability assumed under the provisions ofthis contract, products/completed operations liability and broad form property damage liability insurance coverage. Exclusions applicable to explosion, collapse and underground hazards are to be deleted when the work involves these exposures. The policy shall provide liability limits at least in the amount of $1,000,000 per occurrence, combined single limits, applicable to claims due to bodily injury and/or property damage. New I-lanover County shall be'named as~an additional .insured under this policy..: : , ~ .:~. Automobile Liability Insurance Covering all owned, non-owned and hired vehicles, providing liability limits at least in the amount of , $1,000,000 per occurrence combined single limits applicable to claims due to bodily injury and/or property damage: ~ - Addendum - t The bid package constitutes the entire set of bid instructions to the bidder. The County shall riot be responsible for any other instn.ictions, verbal or written, made by anyone. Any changes to the specifications will be in the form of an Addendum which will be mailed to all bidders who are listed with the Finance Office as having received the bid package. .. .. ~, . -- -:. .Compliance, With Bid Requirements _ ~ ` ' ~ - Fail~ire to comply wit1~ these provisions or any other provisions of the General Statutes of North Carolina will result in rejection of bid. r , Right To Reject Bids The County resen~es the right to reject any or all bids. 1 6 8 I-5 of S TECHNICAL SPECIFICATIONS SULFURIC ACID BID # 99-0039 General Sulfuric acid supplied under this contract shall conform to all the provisions as documented on page T-2. Bidder shall submit as part of his proposal a laboratory specification sheet and a material safety data sheet for the sulfuric acid the bidder proposes to furnish. Quantity: ~ Approximately 12,000 gallons per year '. .Delivery: Bulk delivery of 1,500 to 2,000 gallons Point of Delivery: New Hanover County WASTEC Facility ' 3002 Highway 421 North - Wilmington, NC 28401 uantities Quantities-listed in the Technical Specifications and Bid Proposal Form are estimates only. New Hanover County reserves the right to purchase as much or as little sulfuric acid at the unit price bid -: during~the term of fhe contract:. _ . .. Requests for Shipment Requests for shipment will be made by New Hanover County. The County will allow a maximum of three (3) calendar days for delivery. The quantities shall be shown on the purchase order or specified at the time the order is placed. i SPECIFICATION SHEET ELECTROLYTIC GRADE SULFURIC ACID (H2S04) "`~~~ // DESCRIPTION .....................A/A A COLORLESS TO"SLIGHTLY CLOUDY VISCOUS LIQUID IDENTIFICATION ..:...........:..'.A/A POSITIVE TEST W/ BARIUri SPECIFIC ~RAVITY ................A/A MINIMUri 660 BE OR ~~ (60 /60 F) MINIMUM 1.834 ASSAY.:..' ............. ~.......... MINIM(JI~i 93.19% NON-VOLATILE RESIDUE:........... riAXIMUM 300 ppm ~• SULFUR DIOXIDE...... .............. riAXIMUM 40 ppm NITRATES , AS HNO3 ............... r1AXIMLTM 5 ppm :_ ..__.. IRON .................' _ .... .... i•SAX I MUi•i 5 0 ppm:. . HEAVY t~1ETALS , TOTAL AS Pb ..:... , rL~3{IriU~•i 10 ppm LEAD:.:..:_:' :... i•SAXIMUI~i _ .t~ ppm., . ARSENIC, AS As O ........ 2~iAXII~iiJP~1 l~ ppm ~ i~RCURY....... ? . 3 .......... P•fAXI2•IU1•f 1 ppm CA Df•1IT.Ti~I ....... ............ P•1AXI?•fUi•f 1 ppm COPPER ........... ......... . 1-fAXIfiiUi•1 ~ 1 ppm • ~~~r1TI1•IONY......:.. ~ .:....:.. ?•IAXIP•i'tT•1 1 ppm .' _ SELENIUi•1 ........................ MAXIP•f[Ji•1 1 ppm . Tf~1IS P•iATERIAL SHOULD r1EET OR EXCEED I~fILITARY SPEC OS-801-C. 1 ~ ® T-2 of 2 Vendor's Quote # COUIV'TY OF NEW HANOVER, NORTH CAROLINA BID PROPOSAL FORM BID # 99-0039 -SULFURIC ACID September 1, 1998; 3:00 p.m. I, certify that this bid is made without prior understanding, agreement or connection with any corporation firm, or person submitting a bid for the same services and is in all respects fair and without collusion or fraud. I understand collusive bidding is a violation of state and federal law and can result in fines, prison sentences, and civil damage awards. I agree to abide by all conditions of this bid and certifythat I am authorized to sign-this bid for the bidder. Bid Proposal First Year of Contract: Price S . 88 per gal. x 12,000 gal./yr. = S 10, 560.00 DELIVERED Second Year of Contract: Price S er al. x 12 000 al:/ r. _ ~-:: .:... - S 11 16~.~~ •`1~P g -_ ~, DELIVERED . ?OTAL (Sum of First and Second Year) _ ~ 21,720.00 Manufacturer Intertrade Shipping Point Fayetteville NC Terms Net 30 Days Soecifications Bidder shall submit as part of his proposal a laboratory specification sheet and a material safety data .sheet for the sulfuric acid the bidder proposes to furnish. Any bid ~vhic}~ is not in strict accordance with the County's specifications must ]ist each exception separately in a letter submitted as an attachment to the Bid Proposal. B-l of3 171 s . Notice to Proceed The undersigned, if awarded the bid; hereby agrees.to execute a contract with New Hanover County in the form specified within ten (l0) days after the award and to begin process of providing the sulfuric acid listed in this bid proposal upon receipt of a Purchase Order issued by New Hanover County. ~ .. Addendum. - . ~ . • ~ ' .;.Receipt. of the following Addendum is acknowledged:. ~ ` Addendum No. :Date ~ • , 1998 ~` Addendum No. , Date , 1998 Addendum No. Date , 1998 ,. ~ .. _ m I ' .. ~ . . ~ • _'1 . Z .' 172 B-2 of 3 • A Joint Venture consisting of: Bidder Information Please check as appropriate and complete tl~e items below. The Bidder is: An Individual A Partnership between: X A Corporation organized under the laws of the .State of Virginia (List name of state appearing on the corporate seal and affix seal below where indicated.) BY:. Kevin Kilmartin .. ... ; . ;~z~~J ~.~~~~~~~~ (name as above printed) TITLE: ~14unicipal Sales Ivianaaer C0~'IPANY: Frillaman Che,-ni 1 ~r~2iLation ADDRESS: P. 0. Box 1606 Suffolk, VA '~4'~9-1Fi~F TELEPHONE: (800)876-8383 • SEAL-IF BID IS BY A CORPORATION ATTEST: BY ~~~~-4..e~ ~~ r~ B-3 of 3 173 BL~A C H E M I C A L C O R P O R A T I O N ' P. O. Box 1606 • Suffolk, Virginia 23439 • Tel. (Z57) 539-7401 • FAX (757) 539-1806 HzSOa Fe As Cl Pb Specific Gravity. Pounds Per Gallon Freeze Point SULFURIC ACID Sales Specifications • 66° 980 93.1900 - 93.4000 98.0000 - 98.1000 0 10.0000-- 40.0000 0.1000 -. -1.0000 0.0005 - 0.0010 10.0000 - 40.0000 ppm 0.0500 - 1.0000 ppm 0.0005 - 0.0010 0 0..0001 - 0.0005 0 1.8350 15.3000 -31°F 1.8440 15.4000 29°F Sulfuric Acid is a heavy, oily, slightly cloudy, mineral acid. It..i.s a widely. used chemical agent in many industries such as `.:`production; o.f Fertilizer, Titanium Pigments; Synthetic Fibers; Steel Pickling, _Dyestuffs, Water Treatment and the Paper Industry. Our product meets or exceeds the Food Chemicals Codex Standards and Federal Specification 0-S-801, Class 1 and O-S-809 Type I, Class 1 and 2. For safety and handling information, consult the MSDS Sheet and our nearest Customer Service Center. CUSTOMER SERVICE LOCATIONS SUFFOLK & RICHMOND, VA MARTINSVILLE,VA & JOHNSON CITY, TN P08 1606 POB 402.4 . Suffolk, VA 23439 Martinsville, VA 24115 757 539-7401 540 638-8829 Fax 539-1806 Fax 638-6577 800 944-9457 800 444-2436 CHARLOTTE, FAYETTEVILLE, KINSTON, NC, & LYMAN, SC - 2001 Continental Blvd. Charlotte, NC 28273 704 587-4570 Fax 588-8050 800 745-2436 ozis3Ri vs7 174 t~ACD~ R<.poasib l< DLtrl6utloo Proc<~. Quality • Responsibility • Stewardship '~ ~ - ..' P R; LLAMAN ~a~~ ` PrcduC Safety C`emi©I Ccrocrarcn f'Y'~vi°•• Nc Rlc~mwW, VA P. D. Bcx t EL6 ~ ~~~ 6P c~~P. \ ~ ~ ~' Data SriE~t . AlarCnrnn., va Sut!Clk, VA larrrmn NC C~~ ~~ , O~J N~~ ~3Q , C 3 MAN ~F 2 1 GENERAL iNF ~~~~ ~ E~~"~ ~~~ ~ .. OR,Y1ATiON P E 39 TRACE NAME (G:.1dMCN NAME CR SYNGNYM) I ~ ~ , CAS ~ Sulfuric Acid 660 . 176o""4-g3_g GE'AiCAI ,NAME Sulfuric Acid FcRMUu Ti-SOS . I AGGRESS (Na, SSE.-~.:-, Y, Ss.1rc, ANO c,a c :cE7 ~ . PRJL!_AMAN Cf-iE?Ii11CAL ~ ~ ~ • . P. O..Eox 1666 Suffolk. Vi inia 23434 . ~~_ C.,.rAC' aMCNENUMBER ~ ISSLlcDCA7c R David Vii, Dussia -Technical Manager ~'~0''" (75~ 539-7401 ~, January 19,1990 I JAN. 24, 1997 FIRST A1D MEt1SURES ~ ~- E'ies: Immediately wash eyes with cold running water for at least 15 minutes. Forcibly hold eyelids apart to ensure complete irigaiion of the eye and lid tissues. Victim must see a physician or eye specialist immediately. Continue washing eyes during transit if needed. Skin: Flush affe~ ed area with large amounts of water while removing contaminated clothing uhdersafety ~ • shower. Wash contaminated clothing before reuse. Seek medical attention DO NOT apply creams or .. ointments.. ~, Irihalation: Remove to fresh air.Keep patient..at.rzs-t. If breathing has ceased, give artiticial.respiration, referbly mouth to,mouth. If breathing diifrcult give dxygen. Consult a physician: neest(on: Do rot induce vomiting. Give large amounts of water.Call a physician. Do not give bicar`,,onates. Consult ohvsican or oeisen control center. H~^-,~.ARDS fNFORMA T ION GrLi 7~. :NI-+f L?.-C.Y - :urr,sn heallii ZIiC~.J of overaxresure may include IriltailOn Of the UDpef fe5}")IfatOry pa'SJa'9eS Of 2fOSion Of dental surfaces: high exposure may lead to temporary lung initatien effe~ s with cough, discomfort, difficulty in breathing cr s~~orness of breath. :NGc~..GN May cause severe bums to the mucous membranes of the mouth and esophagus. LD:~G 214Gmc/kc in rats. ' S::,N - ~ . May causz severe bums or ulcerations. Prolonged or repeated contaC, with mists may cause skin irrtation with discomfort cr rash- , ~L1ay cause eye erosion with corneal or conjunctiva ulceration. Repeated or prolonged contaC with mis; may CaUS2 e`/e irr,iallCn with discom(cn, tearin0, or blurinq of vision. atR 'VIII nC( Jrn ~ ,~ •:~~ ~' ~.~~ -~'- .~;a °C i ~ f _ - 5 N:.. • ~-c'= '"('~ ''c-`~ ~r'~;s. 'sce~:all; •,vh,en Ciiu(e. ;c rive rlgr„r,;able. cctenuaily exclcsive hvdrecer, cas 3iCL=.,.C.:L PRE ~,aUT10NSIPROCEt7URE5 ._... .. ..t ~._.-. .. _ ~.... ~...._ .-_. ~.. ~E ~?,ctjrs}+tNc Acs rrs aE~~,we+ca _., ~ ... ... , Use :-e=':a as ac_rc:rate (cr ccmbtstittes in area.:.c:d itself .s .,ct ^amma~!e, ~t.2 may case is,^. ~cn ~/^cr'ad •,~?~ V ,;.'•~~te Ilcu•.ds and sctiGS. Lse water spray to •cxt c-n~ir.ers ex,-rsed :o (Ire. Co nct cei water inside of C..rrtaa;ers In ~ wlxra acid is preser~ tse dry dxmical, c3rDCn Cicxide. cr+rater (ce. ••---• FRE ~~+G::1S}+E~ AGcrrs ~ AVC(D .. ~` ~ .. No Cara available. ~ - 9~Ca~ ~aE ~~G:rnt~G a4E~ttTCnS .. .' .. . .. . _ E•racate to safe area. Keep upwind of f1re. Grnefales heat-upcn additlon cf watrr_with_pcsst~le sing. Wear ftdJ przts~.ve dtr:~hhing..____ Runoff frcrn~fire ccnVCl may cause pottuticn. Neutralize runoff with time, saCa ash, etc. to prevent ~rrt;s:en of meals and fcr;rancn of ttydrogerl cas. Wear self c.-rratr.ed breathin aacaratts. - - - vE.4~7„+%CN l_ccaJ ~t:aust vertilacen may to necessar/ to limit emplcyet e~esure, e3pecally in p producrg'at drisi. Verrtitaticn"wiiT also be necrssar~ to clear scraee tanks crier to erttr~. Feilerv OSHA rrCUtadonz ter tank entry. - _. .. .. ~ ~ r.. '- NCRwI:+ANCL:NG •. .. . riyt:tcSen ,ca3 can be gererate'd insiCe Cntms and tanks, therefore epee Ilghis,.smcking ct st,arta stSci:ld net to perr:.iv.ed near cpen drums or tanks. 'Nt:en ditutina •.vrttt water. aCd ae'd to water NEB/ER add water to acrd. S~CaA'c Keep ~ ", c( sun and away fr=m heat, sparfcs and tiame~_ .Keep diners tfghtty ' , and (drum) ~csura'up to Frevrrt.lealmge. Locsen ,~` demure carefutty, Relieve irtemal pressure when re•c-ived and at least we'ektV thveaRer. Stec "rN i( pcssibte. Review Fre.and czolesicn Hazards" and 'Safety PrecauCens' before procreCing v+iUt dean up. Scale up s-rall sr~s with Gy sar.C, day, cr Ciatcnrace::trs earth. 08ce large spills and cauticusiy dDute. Neutralize with time cr soCa ash, and transfer to wasae treatment svs:e.^t. Prevent !icuiC from ertetine sewers. watervv-avs. cr ICw arena. y:: tl r4==.iViICNS:RCC~Ua~Uo~'115~L'G-:C.VS •. ~ ~. ~ .. ~ .. Ccrrrs::e! UNtBSrJ ~ . . PE:~SONAL FROTECTiVE EQUIPMEV.Z a°v R.47CR7 P4C-s-CY - ~ .. .. . Vr acs Sasses, and mists, rncentraticns toss LSat .0 times the TLV, a chemical cartriCSe respirator approved by NIOSi-'. fcr acd ,cases and `DES ANc ~AC_ - - Sefasr -rdcf ,. es roc- er.dea cr ,ill face shield i!ANCS, 3AM5, nNC 2CCY - , :tC: :.e! y:C~eS SGCt:IC `.e '++C.^.1 .f %C.^.y CC,::aC IS :.C55i Cle. riu~~er safety slices cr rabbet •ncm ever leather safety slices. Wear rt:Cber apron if :~'~ ~. 2c' !s ccssi~!e. :VCr. uA _=.>l:S ~,t~.`~C ~..rn~:~_CVC:i.:.:VS: dPo'11."2.aNCc J.NO CC:.R ~ ~ ~ • I LC~:C Ctear OC!O(te33 IICUId ~ :C:L.`.:. =SIN' l.1i; ~VG ?Cl+i Y=1•C :,aAVriY ;N.J = .) VAPCa CaLSrtt iti2 = :) No dan_ available - = I 1 .835 13.4 SC.'_n._... :N •.vA-.- ;`S cy,wot.-1 :rl ... ~ I VAPCR ?RF_S.SZrR°_ (ri'mr F y~u J~Cr . I :C•:S Less ;lien i accrcx. <0.3mm}-?cJ=~~ =•/A%r F.~-C: r :.A- _._~M ~caara = :) _. ~.e` ~ 1) I `G VCUi, =s' aY vCCUME Nt ~ C., x_'_55 :'cr~ •VO G3fa .. .. ._ _. - - I = i==`• ~ I CcntaC •.vrth metal rcwdera r..ay release hycresea, a hiynly :'.a.-..mac!e Sa . Wiese CiluteC aciCS shculd r.c:.e stores in metal. --c __:~ ;~a . -_ - -raree :ns,ee trcr cr~mt Inc ejrs. Inc _.;ex s, cr mec+ t-ns~ anti .ta rryvrxen .s a tt~mrtn pia Sys, es o:c s... mr~re~ ...c~ a,r uneer cer~:n __-- _ _ - ~~ -~. C.n^ -- '-t to C'~:4 r - ~ ..-..f.:J -nil ~C3~ C=nt]:neff. ~, _ ~_ 176 .. .. - t^ _ ~ ~ ' .. ti. _ ftA.aR000S :~cuYUe~¢A-cv ~NOrrtcNS ro Avow Will not occur ~L,Vone , ,:,~: `~~ .HAZARDOUS INGREDIENTS Mixtures Onl ) MAT :rZ1A~ CR CCMPr'NENr.L..1 ~ I yYr, ~ Sulfuric Acrd: 7604-93=9 93.19 - 93.40 Other ingredients not ciassified as hazardous E~JVIRONMENTAL J. RE=ERENCcS <. ACD(T IONAL INF~7RMA ~ Inr~ Rp pATA !5'E= SE~G'~tCN:1 CECRACA8117TYlACUA7IC 7CX:G'T'Y ~ T;e ~8 hcur T L'+1 in Flcundet is 1 CG3CO ppm. ASuaric toxicity rarce set Ly ~~A as category C. LCSd range is creator than cr equal fo 10 to less 7tan cr ecual to 1CA mCJI. Re!erertce ~0 CFR 118. CC'ANCLNVAT~,R P~RTTCN C~1-1Cc*!T n/a c?A NAZARCCUS SU35':ANCc7 YES X NO IF SO, RE?CRTABL' Ci.:Ar1TTi Y; I 10001bs. ap GR tt0 • t iT WAS- S~SAL'AE'r+CQS (CIS?CSErZ ttUS C :r~PIY'Nf~}I FciERAL SATs AND LQC.~L C•5?CSAI CR C1s~:.~ARGr~WS) Material that has txen irnotved in a spill is ~rtsidered a RCRA Haz~rt:cus'Naste. Do not Gush to surface wafer a sanitary sewer system. Comctv with federal. state. and loll reculatiorts. I(aeorrned. nettrarrze and transfer to waste treatment system. t RC7A SATL'S CF'JNUS^ !AA'~IAL gJf7'CZ Ne. CQO2 .. _ I 30 G3 ^_71_~ NF~A HN11S HEA.LT, . 3 3 F ~~.IV1 ti1;=. c I L! i! 0 0 RE~CTiVI i Y 2 2 FFOTc~C T iVE E'GUIFM~NT rcAT1NG TO cE SLiFFL!FD c'( USc=< Dc=ENDING ON USE CONDITfOi~IS. ~==ti11Sj,cl= C: VC`.4~A'Cv R __ ~E.VC.=.~ OSHA S hcur TWA = 1 ma/m3 ACGIH TL`J = 1 me/m3 ACGIH STcL = 3 ma/m3 RE~UUTCRY SANCARCS E?A SARA Sec;ion302 (Extremely hazardous substance list) :yes, Sec'.ion 311/312 (Hazardous Categories): Acute, chronic, reactive Section 313 (i oxic Chemical Vst): yes. This Drcduc; is listed on the TSCA Invento a.c.' =.1ss,~~c,~.-c.v Corresive Ucuid UN18~0 ~ ~~ cBvE~A~ .. THE DATA PRESENTED HE:RE!N AAE 8E!tEVE'J TO 8E ACCUA.~TE BUT AAE IN .10 WAY GUARANTc.J. PRILAMAN CAE:~tlC,al CGRPCRP,.T IGN .:SSUM:S NO UABIUTY IN CCNNEC7ICN WITH ANY US"c FOR THE PRODUC, $ DISCUSSED ANO iT .~naxE; NO waAR;.Ni!, E.YPRES~ CR IMPLIED, IN THAT ASPEG, NOR CAN IT 3E P.SSUME~ TH,aT All SAF-_ i f `.tEaSURES .ARE IMD~Cf.TE] HE3EiN CA THAT CTHER OR ADC1710NA1. MEASURES ~VtAY 9E RE•DUIRED. 7HE USES. T::ERE='ERE". MUST ASSUME : UL! RESPGNSialUTY, ?OTH AS TO ?~iSONS AND AS TO PROPEPT'f, i1.R THE USE OF THESE .~;,>-c=1AL iNC:UDINC ;.NY USE Y~r:IC-? MIG'r-IT ~E COVE3ED 3Y ?ATENT. i1 177 17~ NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTLON '~ Meeting Date: 09/21/98 Budget Amendment Consent Item #: 5 Estimated Time: Page Number: DEPARTMENT: Various BUDGET AMENDMENT #: 99-0027 ADJUSTMENT ~ DEBIT Planning CREDIT CAMA Grant $20,000 Temporary Salaries $3 500 Advertising , $2 000 Contract Services. , $4 500 Postage " ~ , $500 Printing $6 000 Supplies , $3,500 Cooperative Extension . Coop Block Grant $10,557 Salaries $4 974 FICA .... ' ;. .Supplies ~ : ~ ~ , $380 .. .. ~ - ... Travel ~ ~ _ ,$3;967 . $1,236 . Drug Court . Bureau of Justice Grant $96,530 .~ Contract Services $107,256 Commissioners Appropriate Fund Balance $10,726 EXPLANATION: To rollover unexpended grant funds from FY 97-98 to F`. APPROVAL STATUS: To be approved by Board Of Commissioners COMMISSIONERS' ACTIONS/COMMENTS: '~1- ~~ a~~ ~~ .PD ~,,~ }~~~ ,~ ~~~ ~~ ~ ~~~ .. COUNTY COMMISSIONED ~1PPR4VED G/ REJECTED CI ' REMOVED i~QSTFONED Cl ~A ~° .,.,f~„~ 179 NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST'FOR BOARD ACTION .Meeting Date: ' 09/21/98 Budget Amendment Consent Item #: 5 Estimated Time: Page Number: - - ~ • DEPARTMENT: Various BUDGET AMENDMENT #: 99-0027 ADJUSTMENT Museum Grassroots Science Grant Salaries Temporary Salaries FICA • Retirement Medical Insurance ;Contract Services Printing Supplies Travel Administrative Capital Outlay Vehicles' DEBIT CREDIT $96,578 ' 514,7fi9 ' 512,237 52,168 . 5999 s 51,862 - $21,465 ' 54,229 -518,691 S5,984 51,704 _ 54,910 Aging Foster Grandparent Grant Salaries FLCA Auto Reimbursement Volunteer Auto Expense Volunteer Stipends Human Service Transporation Transportation Assistance Grant Work First Grant Elderly Assistance Disabled Assistance Work First Assistance 569,783 ~. ~ Ss,s2s 5530 5267 55,823 556,237 $34,587 537,404 ~- ~ . 522,201 - 512,386 $37,404 EXPLANATION: To r~olleru~'nezpended~gr nt funds from FY 97-98 to-FY 98-99. ~b ~~~~~~-~~ nISSI APPROVAL STATUS: To be pproved~by=Board Of Commissioners ~~ Cnnfl^ ~ ~4~~I~i3~! : ~pRDv COMMISSIONERS' ACTIONS/C,OMMENTS 1~JECT. ~ FJ} yM~lV ~•~ 1 ~ O ~~- ~P$ R~MOV~" r - y~IRD - ~ ~ ~,~.I ~'f E ill ~~ . NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION Meeting Date: 09/21/98 Budget Amendment Consent Item #: 5 Estimated Time: Page Number: DEPARTMENT: Various . BUDGET AMENDMENT #: 99-0027 ADJUSTMENT Schools Retrofit FEMA-Disaster Resistance Community Contract Services Supplies Travel Other Improvements Administrative Engineering Project Impact-Hazard Mitigation HMGP-federal HMGP-state Salaries DEBIT CREDIT $435,014 $196,987 $63,578 Advertising . _ ... Contract Services Supplies Travel . Capital Outlay ~.:~ ~~~O~~~A . ~ Q ~D~T~~kI~S~ C3 ffiV~~~~ EXPLANATION: To rollover unezpen;~d'e~d~gir~a~n~t~funds from FY 97-98 to FY 98-99. APPROVAL STATUS: ~ ~~ . ~l11~ C~UN'tY tOM>~At~ .COMMISSIONERS' ACTIONS/COMMENTS• APPRaV~~- R~~~:~ R£Mt~lf ~ PI~S'C~ QA1E $63,000 $14 $2,000 $245,000 $3,000 $122,000 $6,255 :$30,000.. 5136,125 $49,604 $8,581 $30,000 181 NEW HANO~IER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION Meeting Date:: 09/21/98 . Budget Amendment Consent Item #: 5 Estimated Time: Page Number: _ ~ •~ DEPARTMENT: Various BUDGET AMENDMENT #: 99-0027 ADJUSTMENT ~ - DE81T CREDIT Cooperative Extension USDA Pesticide Grant • Cooperative Extension Expense Environmental Management-Recycling Waste Reduction Grant $12,500 $12,500 $1,511 Contract Services - -$1,511 Aging-Congregate ~~ .. _ ,.. • .Cape Fear Memorial Foundation Grant _. .. $27,245 _ - •, .•' Contract Service-CFMF Grant - ~ $27,245 ~~ EXPLANATION: To rollover unexpended grant funds from FY 97-98 to FY 98-99. APPROVAL STATUS: To be approved by Board Of Commissioners COMMISSIONERS' ACTIONS/COMMENTS• COUNTY COMMISSI01 APPROVED ~ REJECTED O REMOVED O .. • . pOSTPQN~ O. MEARI? C3 ~1 aA'~it . ~M~1~~ 9~~ ~ . ~~~'~ , ~ "~~ ~ q 1 ~ ~ ~ ~~C ~~ ' n : w .. ~°B'~O NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION ~! Meeting Date: 09!21198 Budget Amendment Consent Item #: 5 Estimated Time: Page Number: , , . DEPARTMENT: Various BUDGET AMENDMENT #: 99-0027 ADJUSTMENT ~ DEBIT CREDIT Juvenile Day Reporting Center Juvenile-Day Reporting Grant $138,856 Contributions from NHC Schools-in kind $163,811 Salaries $9,994 . FICA $817 Retirement ~ $563 401 K $~ Medical Insurance _ $331 - Disability $341 Contract Services ' $60,043 Uniforms $1,875 Buildings $106,000 Capital Outlay - ~ In. Kind (from schools) . = 00 . . .. _ _.- .. $91,659 ,: EXPLANATION: To rollover unexpended grant funds from FY 97=98 to FY 98-99. APPROVAL STATUS: To be approved by Board Of Commissioners COMMISSIONERS' ACTIONS/COMMENTS: COUNTY COMMISSIOiV~RS AP-'nOVED (~' R~J~CTED D REMOVED I~ ' ~ POSTPON~t~ t1 HEARQ ~ ~A'ti`E ,«~~~~l 183 ;~ NEW HANOVER COUNTY INTER-OFFICE ~ ' ' -MEMO September 9, 1998 TO: Allen O'Neal County Manager FROM: Bruce T. Shell ~~~~ Finance Director uj RE: Grants Rollover Budget Amendment As you know, many of the County departments receive grants from the state and ffederal ' governments. These grants range from Museum; Department of Social .Services, .Transportation, N.C. Cooperative Extension Service, Environmental -Management, .Department of Aging, Disaster Grants, CAMA, and .Drug Court:. Iri most of ftiese cases, since the federal year end is different from the state and local year end, a budget rollover is required. The total rollover totals X1,250,000 of which $10,726 comes from fund balance. Our fund balance was increased by $10,726 at 06130/98, therefore, this is not an increase in County funds. This is a budget amendment that is done each year: if you should have questions, please give me or Dottie acall. BTS/ct cc: Cam Griffin, Budget Director Dottie Ray, Accounting Specialist II ® 9di~ .- ~ ~ ~~~P~Q~,:~~i l~$ ~Ip~y~~Y2S}9 184 r~ NEW HANOVER COUNTY BOARD OF COMMISSIONERS - REQUEST FOR BOARD ACTION Meeting Date: 09/21/98 - . Consent Item #: 6 Estimated Time: Page Number: Department: Governing Body Presenter. Lucie .Harrell - Contact: Lucie Harrell SUBJECT: Resolution: Request to add Strata and Callie Streets to the State Highway System BRIEF SUMMARY: Mr. James Carl has requested the NCDOT to add Strata and Callie Streets to the State Highway System. The roads are located in the Hidden Forest Subdivision. As recommended in the attached letter, the County should adopt a resolution to add the roads. RECOMMENDED MOTION AND REQUESTED ACTIONS: ' Adopt Resolution - FUNDING SOURCE: ATTACHMENTS: ... _ ~ .. - Letferfrom NCDOT:and SR-1 Petition ITEM DDES NOT REQUIRE REVIEW COUNTY MANAGER' ENTS AND RECOMMENDATIONS: • Adopt Resolution. COMMISSIONERS. ACTIONS/COMMENTS: COUNTY COMMISSIONERS APPRO'JCD C~ REJECTED ^ ,REMOVED Q Pt)STPONED p wE~R~ a 185 „ 1~ . Q~~- . 4 1998 SEP STATE of NORTH CAROLINA ~ ~ ~. ~" _ - DEPA RTMENT OF TRANSPORTATION JAMES B. HUNT JR. E. NORRIS TOLSON GOVERNOR SECRETARY September 1, 1998 Division 3 /District 3 New Hanover County Ms. Teresa Elmore, Deputy Clerk New Hanover County Comnussioners _ 320 Chestnut Street ~ .~ Rm. 30S - Wilmington, NC 28401-4093 - - ' Dear Ms. Elmore: ...: This office is considering the addition of Strata Street Extension SR 1163 and Callie Street in Hidden Forest Subdivision (Div. File No. 912-N) to the state system. After the Board's consideration, if they concur with our recommendation, please furnish this office with the county resolution and official road-name for our further handling'. . If I may be of further assistance,. please advise. ,_ Very truly yours, . David L. Thomas, P. E. District Engineer DLT:sec 2~1~~i2~1~~;"~~j'''J Y"fi~~l:~!~ LJ.a to i...~Y~~i ~T~ Attachment ~ ~~ ~ ~""`"~A ~ ®~l~~ft{1~A cc: Mr. Joe Justice ~ ~~~`~ ~ , ~ Q=~D~ 1~6 124 Division Drive, Wilmington, NC 28401 (910) 2S 1-26SS . ~ ~n NORTH CAROLINA STATE DEPARTMENT OF TRANSPORTATION Auk 1 ~ fig! DIVISION OF HIGHWAYS PETITION ~iViS~u.3 AUG 1 9 1997 ~orth Carolina ~/ ~"'Co un ty o f /VPir / C7a-/z d y~ f' Petition request for (check one) Addition to State System (N'. Paving ( ) Maintenance ImprovCem~ent ( ) ~~~ be ' wners on ~T I~G= ~' ~~/~~ `~~ ~ ~'~' nn the dersigr~e ,. ~~p ~ Describe or give local name or z3t7~ ~ f' ~ County do hereby r uest he . ~/ econdary Road Numoer i n ~~~ ~/'~~ f~~ Division of Highways of the ..Department of Transportation to ~~_~r the above-described road. f ~~~~- GZ.~~21~ i s lt~ - We further advise that the road requested to occu ied homes ~ate~~~ in length and at the present time there are ~~ 1-U• the road and having entrances into the road. ~~ C o~ 1~ Finally, we agree to dedicate to taed Dovtheominimumgconstructiontstandardsf the necessary width to construct the ro required by the Division of Highwaysd-toTbesimprovedfandywilllinclude the necessary length of the road that is requeste areas outside the right-of-warifht-of~waydinlthesp~bli ca roadrintegsectAons~~for agree to dedicate add~t~onal g sight distance and design purposes and to execute said right-of-way agreement forms that will. be submitted to us by representatives of the Division of Highways. .. REMARKS . Four copies of recorded subdivision plat enclosed if applicable PROPERTY OWNERS _ ~. J~ 1~~. ~~ ~l'C~ e~ TELEPHONE~S~~~/~ NAME I /~~~~ 1 v~ ~~ MAILING, ADDRESS ~~ r The Division ofi Hi hways should contact the first petitioner listed below: ~ e ~~ d ~ ~ ~~7 Sad ~~~~ Revised Form SR-1 (5-83) All previous forms obsolete ,. i ~.. ~. _ . . _ _ ,/ ~ ~~ --~ ~ % . .. .. \ ~ \ (~° N .. ~- ' 1 : _n G U g ,~~ ~ _ 'l 'i, _ j I ~ ~ ; I ~ . m ' I .. ~'~ 7' .. .. l 'i •~1' '~'~ \'\.~_ - X97 ~ . ~ ~ ~, i~ B y ~ -~ -- ` J ! ~t _ _t :u: .~ J a ~ ,,s'~ Sr'AGAT~ ,\ ~ ;` .._ _. _'. -. pan ,ery ~a~ ~ _ ~ .~ pax ~ -- - -~ ~ .._ -- -f - ~ ~ i/ \/ . ~~r ~ ~ ~u ~~ ~ ~_'- ~ N ~ ~ ~~~ '~ - ~`~ NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION Meeting Date: 09/21!98 Consent Item #: 7 Estimated Time: Page Number. ~ ~ . Department: Governing Body Presenter: Lucie Harrell ~ . Contact: Lucie Harrell SUBJECT: Proclamation: Declare Saturday, September 26, 19.98 as Hunting and Fishing Day in New Hanover County BRIEF SUMMARY: The North Carolina Wildlife Federation has requested the County to proclairrt September 26, 1998 as Hunting and Fishing Day in New Hanover County. The Board has proclaimed the day for the past four years. 'RECOMMENDED MOTION AND REQUESTED ACTIONS: Adopt proposed proclamation FUNDING SOURCE: ATTACHMENTS: . Letter.and proposed proclamation from. Noith Carolina Wildlife Federation ' ~ - ITEM DOES NOT REQUIRE REVIEW COUNTY MANAGER'S COMME S D RECOMMENDATIONS: Adopt proposed proclamatio . COMMISSIONERS' ACTIONS/ O ENTS: COUNTY COMMiSStQ APP^ ~VED L~ REJ ~'~ StD D RE~,~OVED Ci . POSTPtJNED ~ HEARD ~qq ~, , I ~ Q!1?E rwwruwM i~Ml'' O~~N C.o.Rp< ,ti 19 ~~ 45 L ':NVIRONM ~NTA~_ Z. OUALI'~ V O~ F FEp~ August 28, 1998 NORTH CAROLINA . WILDLIFE FEDERATION. Affiliated with theNationaZ Wildlife Federation P.O. Box 10626 RALEIGH, NORTH CAROLINA 27605-0626 (919) 833-1923 FAX (919) 829-1192 Ms. Lucie F. Hazell Clerk to the Board 320 Chestnut St., Room 305 Wilmington; NC 28401 Dear Ms. Harell: _:.-~ ~,~.-~ ~~ 1996 any 3 ~ ~~.~. '^ . , . ..~ ~~ _ For the past several years the New Hanover County Commissioners have been asked to declare the fourth Saturday in September as Hunting and Fishing Day in New Hanover County. On behalf of the N.C. Wildlife Federation and the N.C. Wild}ife Resources Conunission, I am ~~-riting to ask that this issue be included on the agenda for the upcoming Commission meeting so that they might consider issuing a similar proclamation this year. The N.C. Wildlife Federation beleives that the positive roles of the sporting public should not go unrecognized. Sportsmen and women provide revenues to protect and enhance fish and wildlife populations and to improve _ the quality of wildlife habitat. In addition, y~e thinl: that the strong conservation ethic among true sportsmen. and . women should not be i~ored but should be shared and that is why we strongly suppoit this year's theme -= "A Natural Invitation to Step Outside." Annually, North Carolina's hunters and anglers contribute over $20 million to the N.C. Wildlife Resources Commission's conservation programs. These programs have benefitted hundreds of wildlife and fish species, from deer, quail, Mild turkey, striped bass and brook trout to otters, bald eagles, alligators and songbirds -- fish and wildlife that all North Carolinians can enjoy and appreciate. Enclosed is a sample proclamation for Hunting and Fishing Day and a press release to help inform your commissioners of the value of hunting and fishing to the citizens of your county. I have also included a postcard for you to return and let us know if your county ~~=ill be recognizing,September 26, 1998 as Hunting and Fishing Day. Thant; you for this opportunity to recognize an important piece of our national and state heritage. If we can be of assis anew-e, please3eonfact?L~s~West at (919) 833-1923. C) G~~ '~ Sincerely, ~ Q~~b" .,, ~;~ ' ///^\~I ~.. I b Dale Hosteller, P~de~nt~'~ North Carolina Wildlife Federation /lg~v _ Enclosures 190 printed on recycled paper RESOLUTION NEW HANOVER COUNTY BOARD OF COMMISSIONERS ,. WHEREAS, hunting and fishing have always been, an important part of the North Cazolina tradition. For over 100 years hunters and anglers have been at the forefront of the conservation movement giving of their time and finances, providing over $20 billiori to wildlife management programs and contributing $3.5 million per day nationally. In 1996, North Cazolinians contributed nearly 30 million for licenses and wildlife stamp and excise taxes on sporting equipment. WHEREAS, this financial support has provided the basis for scientific research, habitat restoration, and education which have led to the dramatic come back of wildlife in North Carolina such as wild turkey, river otters, tundra swans, and other waterfowl, alligators, shore birds, bald eagles, and other raptures and fur bearers, and WHEREAS, hunters and anglers are important to the economy, with the average sportsman spending $1,024 on food, lodging, equipment, real estate leases, and conservation fees, it is hardly a surprise that one million jobs are directly or indirectly supported by hunting and fishing,.... _.,... _ . WHEREAS, dollars and cents alone do not represent the true worth of outdoor traditions, the respect of the natural environment and its wildlife is greater than wealfli. Greater still are the ethical hunters and anglers who share this treasure with a youngster, friend or relative. NOW, THEREFORE BE IT RESOLVED, in recogni#ion.of past and current conservation achievements of ethical hunters and anglers in New Hanover County, the New Hanover County Board of Commissioners do hereby proclaim Saturday, September 26, 1998 as Hunting and Fishing Day in New Hanover County. NEW HANOVER COUNTY BOARD OF COMMISSIONERS [SEAL) William A. Caster, Chairman . • Lucie F. Harrell, Clerk to the Board '191 Tliis page intentionally left blank .. . .. .. . ~ - ~~~ ~~ ~ ..~ .: . ,, 192 C~ • NEW HANOVER COUNTY BOARD OF COMMISSIONERS REQUEST FOR BOARD ACTION . Meeting Date: 09/21/98 Consent Item #: 8 Estimated Time: Page Number: Department: DSS Presenter: Wayne Morris Contact: Wayne Morris/Pat Melvin SUBJECT: Electronic Benefits Transfer -= Customer Training : BRIEF SUMMARY: New Hanover County Food Stamp program is scheduled for conversion to Electronic Benefits Transfer (EBT} effective February 1999. Federal/State policy requires that face-to-face training on the EBT process and the use of the EBT card be provided to one member of each Food Stamp household during the month before conversion. New Hanover County is serving approximately 5,600 households per month in this program. This means that some 300 clients must be trained each work day of January 1999. .Neither sufficient staff nor space is available to manage this task internally. Thus, bids were solicited and received for the provision of customer training services. Two bids were received. Both bidders .qualified to provide services. Service Designs Associates' proposed cost for services is $80,113. Lockheed-Martin's proposed cost is $120,243. The DSS Board accepted a staff recommendation to contract with Service Designs Associates on April 22, 1998. Authorization to enter a contract with Service Designs Associates is requested. . RECOMMENDED MOTION AND REQUESTED ACTIONS• FUNDING SOURCE: Funding is in FY98-99 Adopted Budget (50% of cost will be county funds) ATTACHMENTS: REVIEWED 8Y: LEGAL: N/A FINANCE: Approve BUDGET: Approve HUMAN RESOURCES: N/A COUNTY MANAGER'S COMMENTS AND RECOMMENDATIONS: Recommend approval. Please see attached memo from Wayne Morris. COMMISSIONERS' ACTIONS/COMMENTS• V + COUNTY CD MI,~~'~AN~RS APPROVE. . REJECTED 0 REMOVED ~ POSTPONED O - HEARD ~Z, L.j~ DATE ~ ~ 3 l~~~L~UI~ILS~ SFP ~ [ 199 NE1N HANOVER CIS II7~~r~~~1C~ - MANAGFR'$ M E M O R A N D U M ._ to: Allen O'Neal, County Manager 1 . from: F. Wayne Moms, ACS«' L `~ subject: Electronic Benefits Transfer -Customer Training ,.. date: ~ August 20, 1998 I~Tew Hanover County's Food Stamp program is scheduled for conversion to Electronic Benefits • Transfer (EBT effective February 1999. FederaUState policy requires that face-to-face training on the EBT process and the.use of thz;EBT card be provided to one member of each Food Stamp household during_the month before, conversion. We are serving approximately 5,600 households per month in ,our program. This •number is unlikely to change significantly. This means that we must train approximately 300 clients'during each work day of January 1999.• We-have neither the sta$'nor the space to manage this task. Two national firms offer client EBT training to counties: Lockheed :Martin and Service Design ~Associ~tes (SDa).~ Staff have researched both. Both companies provide the services mandated by the,State. Both will arrange for training facilities, provide equipment, hire and train sfa$~, schedule appointments and pro~•ide the hand-on training. .. There are, however, differences. `i'ithLockhewi-Martin, the State will monitor contract compliance. - With SDA, that responsibdity will rest with 'us. ~ Lockheed-Martin will pass on the cost of postage to the client estimated at 52,S67.00. SDA will absorb the cost of the postage: Lockheed=Martin will provide all equipment. «'ith SD:~ the county will lease the Point of Sale machines and the PIN machines at an estimated cost of S297.00 as Citibank «~ill lease the machines only to Lockheed- Martin and counties. SDA will also commit to maldng every effort to select at least 60% of their stafr' from our Work.First participants. Lockheed-Martin will charge S20.96 per individual trained and will~pass~'on postage costs to the County. With an estimated 6,600 hundred client trainees, the cost will be 5117,376.00 plus an estimated 52,867 for postage for a total of 512,0,276._, SDA will provide the service for a flat rate of 579,876.00. In the unlikely event that-the number of clients to be trained should fluctuate by 20% or more, SDA «ill renegotiate the cost, The County will receive 60% reimbursement, for either contract. ~ ~ -- ..::.;:.a:~%i: "~: ::;:,\\\\Z:'^?~`W`0::::\v.~ `t W ':o:~iCC:n\;:~".ar:.: ~::` ":.<"h;:^ «:\2~cic::i::"a~: :"..:.:Y•X~ .M.:.~::c; ...fir ~~\ ck:<d:~:x ....~w::..: ~. s~eecc[ S 77 . ~ ...: ~;::~ \` ~ ~ ~ , \; ! .. .. . ~ ~ 'i :F~: ~~ ~w~ +GtJ~~- i ' '~ ~ _ .~~ „~ .'.C^... ...._~.„ _ ~~ \. <wv ~~ ~. ~ a . ~ ~;;. ::\> \. \ \ `\\\ `\Q \~~ . ` '^.~ . \ J. '~ ~ ~::. \t.~: J`\ h ~~\ ~ \~ ~. \.. ~~ v .^: \~{~ ~:.. :~\ ..~; ~. \~J~~ ~ ~`t~ w~ ::~ ~:~ n ~: ~'~ ~ ~;;»>~ : .. .~: : ~: i: ~ . w ~ ; : ~.... ....::.: ~...::..:. ~..:..:: ~ ~..~v. J6L:L :.. ,».~M ~ \ ~ ~ ` ~`~ ~~6 0:O~~~S20.96 = 51 17 376 ~ flat rate 579 816 . , , ~' " ~ ~ ; ~~ ~^~~~~`~' ~I?os~a~ Estimate S2 867 POS S PIN Lease 5297 20 2 3 A ~ "~` ~'~~ ~~ ~~ ~ 5 . , 4 1 '~~'n is 580,113 fem. State of North Carolina _ '~ ~ . County of New Hanover NHC Contract m 99-0076 This Agreement is made and entered into this day of 1995, by and • between Service Design Associates, hereinafter. referred•to'as `'Contractor" and I~Te~4 Hanover County Department of Social Services,.hereinafter referred to as •"DSS".' - " - _.. «'ITNESSETH: Whereas, the North Carolina Department of Health and Human Services eritered~into a contract ". ' `with Citibank F.S.B. of Florida to impiement~an electronic benefits transfer ("EBT'.') system for delivery of certain benefits to its clients; and Whereas the contract, DHR-497-96, reserves unto DHHS the right to4allow each county { Department of Social Services to contract for training sen•ices outside of the primary contract; and Whereas the New Hanover County DSS has requested and received a Proposal for Training services from Contractor, and Whereas, the parties hereto desire to reduce the terms of this agreement to writing; and . Now, therefore, in consideration ofihe mutual promises set forth herein, the parties agree as follows: 1. That the Contractor sha(1 act as an independent contractor and sha(1 not represent himself as an agent or employee of New Hanover Count, for any purpose in the performance of the . Contractor's duties under this contract. Accordingly, the Contractor shall be responsible for all federal, state, and local taxes arising out of the Contractor's activities in accordance with this contract, including federal and state income tax, social security tax, unemployment insurance taxes, and any other taxes or business license fees as required; 2. That the Contractor shall complete a ~~'-9 form at the time the contract is signed. If this form is not received in the Accounting Office, backup withholding will be initiated. Contractor will be issued a 1099 if payments are over SIX HtNDRED DOLLARS ($600.00). The Contractor shall file necessary federal and state tax forms; 3. That the Contractor is an equal opportunity employer and it is in compliance with all laws and regulations governing the requirements of the Equal Employment Opportunity Act, the Department of Labor and Title VI of the Civil Rights Act of 1964. The Contractor hereby assures that it shall comply with Title VII ofihe Civil Rights Act io the end that no person shall, on the grounds of age, race, creed, sex, or national origin be excluded from participation in, be denied the benefits of, be otherwise subjected to discrimination under this Contract or under any project, program or activity supported by this Contract. The nondiscrimination clause contained in Section 202 Executive Order 1 1246, as amended by Executive Order 1 137, relating to Equal Employment Opportunity for al( persons without regard to race, color, religion, sex, age or national origin and the implementing rules and regulations prescribed b the Secretary of Labor, are incorporated herein. 1 ~9 ~ Program for Employment of the Handicapped (Affirmative Action); regulations issued by the Secretary of Labor of the United Slates in Title 20, .Part 741, Chapter VI, subchapter "c" of the ` ~ Cod'e of Federal Regulation, pursuant to the provisions of Executive Order 1 1 ' 7~8 and Section 503 ,. - of the Federal Rehabilitation Act of 1973 and the American Disabilities Act'of 1992 are . incorporated`herein. _ ' ' 4. That the Contractor warrants and certifies that he is in fiilf compliance-wifh thz ' - Drub-Free Workplace Act of 1988; - ' ~ 5. TERM: That the term ofahis agreement shall be for the period of time beginning November 1, 1998 and shall continue until February 28, 1999, unless terminated pursuant to the terms of this contract .contained hereinafter. In the event the implementation date for the EBT - . system is delayed or postponed, the Germ of the agreement will be renegotiated... . ` 6. ~ TERMINATION: If the contractor shall fail to perform its Contractual ~• obligations and duties,.after having been given a reasonable opportunity to do so, the DSS shall thereupon have the'right to terminate this Contract-by mailing written"not-ice to the Contractor of such termination and specifying the effective date thereof. 'A reasonable. opporttiniry to perform under this Contract is defined as within (1 ~) days of the date of.notification. . In the event ofternination for default, the Contractor shall be paid for ser~~ices provided and accepted by County. - . ' If the contract is terminated for default, the Contractor shall be liable to County for any damages-sustained by County .-_ - ' ~ DSS may terminate without cause in whole or in part.w-henever for any reason, in its sole / .. - discretion, DSS shall determine that such termination is in the County's best interzst. .. The Contractor may terminate this Agreement in writing at any time with ~O days.notice to the County. If the Contractor as provided herein terminates the Contract, ahe Contractor shall' not . ~ ~ be }table for any damages that are attributable in whole or in part to the County's failure to - ~ perform it's responsibilities. - ~ . 7.MODIFICATION IN WRITING: That-this Agreement may be modified upon mutual consent. of both parties by a written amendment at any time; _ , .. ~~ ~ 8. ASSIGNMENT: That this contract, or any-right hereunder, shall not be assigned by any party, nor any duty hereunder delegated by any party without the ~i7itten consent of the . other party, and such assignment and/or delegation without said consent shall be void; 9. , JURISDICTION/CONTROLLING LAW: That this agreement shall be governed and construed.in accordance with the laws of the State of North Carolina. All actions relating in ~ - ,.any way to this contract shall, be brought in the General Court of Justice of the State of North - •, Carolina, venue to be in New Hanover .County, North Carolina;, - - = ~ ~ .. 10. ENTIRE AGREEMENT: This agreement includes-and incorporates the entire • and, only agreement of the parties concerning the subject matter. It supersedes all prior negotiations, understandings, or agreements whether oral or written, concerning the subject ~'~~ • - ? , •. _ .. , ~ . ] 1.~ SERVICE PAYMENTS: The Count~~~`agrees to .pay to Contractor-for services: _ Compensation at the.rate set. below to represent full and complete compensation forservices rendered under-the terms of this Agreement with total cost to the County not to exceed $79,816. The parties agree that all monthly service payments shall be paid to Service•Design Associates, 22~ Hillsborough St, Suite 290, Raleigh, N.C. 27603 .- And Whereas, . 12.. GENERAL: This-"section contains the Perms and conditions of.this Contract. This Contract •is also subject to the provisions of all applicable federal-and State laws, regulations, .policies; and•standards. If in the event there•is a•c`onflict between a term and condition of this contract and, federal and state law, federal and state law shall prevail. The Contractor agrees that all DSS case files will be maintained and used solely for the intended purposes ofthis contract and safeguarded as provided in Federal law and 108A-80. 13.~ : _ AMENDMENT: No modification or change of-any provision in this Contract ,,F shall be made, or be,construed to have.been made; unless such modification is a~eed to m~;writing by the Contractor and the pSS, and incorporated into a~w-ritfen amendment to~the Contract. ., Except DSS has the right to require revisions made in the scope of work necessary to meet new or revised rules, regulations', laws;.policies;~ grid standards: The C~ounty's'Contract Administrator shall make such written requests. Any request made by an}' other person(s) shall not be binding upon the Board as an amendment to the Contract or a change in scope of work.,...{ _ . ~~aiver of any, breach-of any.terrri or condition of the Contract shall not waive any prior or - subsequent breach. No term or condition of this contract shall be:tield to b'e waived, modified or -• 'deleted except by written instrument sided by the parties hereto. ` ~. , ~ ~ ~ . ; 1,4.,. ~ PLACE OF CONTRACT: It is agreed'beni'een theparties hereto that the place of this Contract, its situs and forum, shall be New Hanover County, North Carolina, and in said County and State shall,all matters, whether sounding in Contract or•tort relating to"thz validity, construction,.nterpretatign, and enforcement of this Coriiract be deterrriined. y ~ • 1~. RECORD RETENTION, INSPECTION, AND AUDITS:'The Contractor a~ees to maintain fiscal books, records, documents, and other evidence,~'hich reflect all direct and indirect costs. expended under this Contract. The Contractor' shall maintain pan accounting system in accordance with generally accepted. accounting principlzs: The County, State or the Federal government shall have the right to inspect such records at its convenience. .. , Lt is ,understood~and;agreed by the Coritractorthat the Contractor shall be liable for,any State or Federal audit~exceptions and shalt return to the County all payments-made under the Contract to which exception has. been taken' or whichh'as been disal~low''ed because of such an exception. The-Contractor shall agree to`ihe conditions of 4~ C'FR; Part 74:24(a),•'(b), and (d) regarding recent-ion and access requirements relating•to all financial and programmatic records,. support documents,. statistical records; and' other records of This Contract. In addition, the , .. contractor shall agree to the following terms regarding record retention of contract records and access for government officials. ~,~ ~; , • . , - :~ ~, ,4. i ,.. - 1 ~9.8 ~ e l; 3 .Unless County specified in writing a shorter period of time, the Contractor agrees to preserve and make available all other pertinent books, documents, papers, and records of the contractor involving transactions related to the contract for a period of five years from the date of expiration or termination of Contract. Records involving matters in litigation shall be kept for one year following the termination of litigation, including all appeals if the litigation has not terminated within five years. • The parties agree that the records subject to audit shall be limited to records related to this project, and specifically excludes records relating to Contractor's general policies and information on Contractors overhead and profit rates. _ • 16. PRICE.PROTECTION: The quoted prices shall not change during the term of this Contract except as set forth in this subsection. Any dovrnward price changes during the Contract period must be general, either by reason of market change or on the part of the Contractor to other customers. Notification shall be given to the Contract Officer in writing, concerning any proposed price adjustments. Such notification shall be accompanied by copy of manufacturers' notice or other evidence that the change is general in nature. The County shall receive full proportionate benefit immediately at any time during the Contract period. _. 17. INDEMNIFICATION AND RELATIONSHIP OF PARTIES (A) The Contractor shall be an independent Contractor, licensed and bonded and solely responsible for the employment, acts, omissions, control, and direction of its employee. The " Contractor shall save and keep harmless and indemnify the County against any and all liability arising out of the operations or performance of the work by the Contractor or its employees in ` • . connection with, the Contract.. The Contractor shall not be deemed an employee of the County. .. , ... (B) In no event shall the Contractor be liable to State or to any third party for consequential, special, indirect or incidental damages arising out of the use or inability to use any software and /or services, including, but not limited io, loss of data or information of any kind which the State may experience, or fines or penalties imposed on State for failure to meet a governmental law, regulation or requirement for which the software and or services are directly or _ indirectly used by State. . 18. INSURANCE: .The Contractor shall maintain General Liability insurance coverage in sufficient amount io protect the County, its agencies, its employees, its customers, and the general public against any loss, damage, and/or expense associated with the performance of its duties. The Contractor shall defend, at contractor cost, any and all. claims asserted against the county, its agents, or employees arising from the performance of this contract. The County will cooperate with the contractor and may participate in any defense at the county's expense, at the County's sole discretion. No settlements in any of the claims will be entered into by the Contractor, except upon the prior w7itten consent of the County. The insurance coverage shall include general liability, malpractice insurance, and other appropriate professional liability. The county shall be named as a co-insured and entitled to all notices issued under the policy, to cover claims that may arise out of or result from the Contractor's services hereunder. Written evidence of insurance shall include, but shall not be limited to effective dates of coverage, limits of liability, insurer's names, policy numbers, and endorsement of representatives of the insurance company. The evidence of insurance must be submitted upon award of the contract. In the event the insurance coverage is canceled, the county must be notified within thirty (.i0) days prior to the cancellation of any coverage under the policy. 199 4• 19. PERMITS, LICENSE, TAXES, AND STATE REGULATION: The Contractor shall procure all .necessary permits and licenses-and abide by all applicable laws, regulations and ordinances or aII Federal, State, and Local governrrients in which work under this Contract is performed. - ~ ,~ 20. STATE AND/OR COUNTY PROPERTY: The Contractor shall be responsible for the proper custody and care of any County or State owned property furnished for the Contractor's use in connection with the performance of this Contract, and the Contractor shall reimburse the County and/or State for its loss or damage, normal wear and tear excepted. • 2 L SITE RULES AND REGULATIONS: The Contractor shall use its best efforts to.ensure that its employees and agents, while on State premises, sh'alI comply with site rules and regulations.. - 22. INVOICES AND PAYMENTS: The Contractor shall be paid in accordance with the following payment schedule. The Contractor shall be paid orie half of the contract price when the scheduling and preparation tasks have been completed and the balance of the price when the classroom training is completed. County shall make a reasonable effort to achieve Contractor payment within 30 workdays after receipt and approval of invoice. Scheduling and preparation will be located within the DSS so that appointment scheduling, tracking, and rescheduling Gan be coordinated. This will be handled by one manager and two schedulers, and will require the use of one office and two telephone lines (furnished by the contractor). Additional staffwill be utilized as necessary. In the 30 days prior to EBT implementation three training teams will perform S-6 training sessions per day, 3S customers per session,•to ensure training availability to all customers. Evening and Saturday training sessions will beheld=to-ensure availability of training to all. customers. If DSS can identify groups of customers ~i•ith special needs, these groups will be scheduled in separate classes. to better accommodate them,~i:e. Spanish speaking who may need an interpreter._ The Contractor will schedule appointments, mail appointment letters, reschzdule appointments for customers, and send~a 3`~ appointment notice to.customers who,miss their initial appointments. The Contractor-will have the capacity to conduct' EBT training for.7,02~ customers. Adequate staffwill be hired to perform this training. In addition, a security guard will be hired to be on duty at the training site during training hours, unless this is provided by the site itself. The New Hanover County DSS will rent three (3) POS machines and six (6) PIN.selection devices to be used-by the~contractor during the customer conversion training. The New Hanover County DSS will provide the required written training materials and training videos provided by the state. The contractor will provide the required space to conduct the customer conversion training with DSS approval. The contractor will make a reasonable effort to hire at least SO% Work First clients, referred by DSS,~to assist with the scheduling and the training process. . 23. CLEAN AIR AND WATER ACTS: The Contractor shall comply with all applicable standards, orders, or requirements issued under Section 306 of the Clean Air Act (42 U.S.C. 1857(h), Section S08 ofthe Clean Water Act (33 U.S.C. 1368), Executive Order 1 1738, and Environmental Protection Agency"regulations (40 `CFR Part 1S), as well as with all applicable requirements of OMB Circular A-102. ' 24. FORCE MAJEURE: The Contractor shall not be liable for any excess cost to the State if the.failure to perform the Contract arises out of cause beyond the control and without the fa((u~~lt or negligence of the Contractor. Such causes may include, but are not restricted to, acts of ~OV `l ~, God, fires, quarantine restriction and freight embargoes. The Contractor shall take all possible steps to recover from such occurrences. 2~. NOTICES: All notices and invoices shall be delivered to New Hanover County Department of Social Services, PO Drawer 1559, Wilmington, North Carolina, 28402-1559. Send _ to the attention of Mr. F. Wayne Morris. Either party may change its address for notification purposes by giving notice of the change and setting forth the new address and an effective date. 26. SEVERABILITY: if any term or condition of this.Contract or the application thereof to any person(s) or circumstances is held invalid, such invalidity shall not affect other terms, conditions, or applications which can be given effect without the invalid term. condition, or application, to this end the Terms and Condition of this Contract are declared severable. 27. CONTRACT ADMINISTRATOR: The Contract Administrator is the County Manager or his/her designee. Such other designation shall be in writing. IN WITNESS HEREOF, the parties have caused this instrument to be executed in duplicate originals in their respective names, and have sealed the same, on that date and year fast above written, by person duly authorized. NEW HANOVER COUNTY .. ... ...• y .. .. •County Manager • 201 b ~ ~_ ,. ATTEST: ,Clerk . STATE OF NORTH CAROLhtA ` COUNTY OF NEW HANOVER .. ~~ ~ ~ ;,as•Notary Public, do hereby certify that the above riamed personally appeared before me this day.arid acknowledged that she is the Clerk to'the Board of Commissioners and that, by authority duly given as the act of the New Hanover County Board of Comrrussioners, the foregoing insiruinent was signed in its name by the County Manager, sealed with its corporate seal, and attested- by herself as Clerk to the New Hanover County Board of County Commissioners. a .. Witness my hand and notarial seal, this the da of y. , 1.998 Notary Public ' My Commission Expires: ,. ~ ~ 202 f, Service Design Associates By: Dennis Corriveau Owner/Treasurer WITNESS: NORTH CAROLINA WAKE COUNTY I, , a Notary Public, do hereby certify that ,personally appeared before me this day and acl;nowlEdged that he as an officer of Service Design Associates and by authority dul}~ given is authorized to enter into this Contract and such action is binding upon the corporation as the act of the corporation, the foregoing Contract was signed in its name by the Executive Vice President, sealed with its corporate seal..... ~ _ _ , Witness my hand and notarial seal, this the day of , 1993. Notary Public My Commission Expires: - I• 203 g Addendum Authorities For Corporate Signature 204 ~) • i~ ~ - - NEW HANOVER COUNTY BOARD OF COMMISSIONERS - REQUEST FOR BOARD ACTION Meeting. Date: 09!21/98 . • .. Additional Item #: 1 Estimated Time`. Page Number:. ~ •. - ~. Department: Planning :Presenter: Dexter Hayes " Contact: Dexter Hayes, Kemp Burpeau ~ ' , .. , SUBJECT: ~ ; :, ,Rezoning Case #or•Rudie Malpass at Piner Rd. ~ ._. ' ~ - ,BRIEF SUMMARY:- Chairman Caster received the attached letter from Rudie Malpass concerning the appealed rezoning. case heard by the Commissioners at their September 8th .meeting. A motion for approval. failed and no ;. ' other action was =taken by the. Board. In order to keep the petition alive, Ms Malpass'is asking the Commissioners to send the case back to the , ::Planning Board so that she could modify the petition and submit aconditional-use request... As you may recall a previous request to re-establish a Conditional Use Zoning on the property in June, 1997 was ' denied by the. County. `RECOMMENDED MOTION AND REQUESTED ACTIONS: ~ . In conferring with the County Attorneys' office it appears that the Commissioners have a couple of options.' •~ _ Since there was ,not a formal denial of the petition. at the last meeting, the Board at their discretion may ` remand the petition back to the Planning Board in order for them to consider aConditional-Use request. .. Or ,, ..... _ . p ,~ if the:Commissioners desire to rnake:a formal ~decisior;.of denial.for the current etition then we will- "` need to re-advertise the case and place it back on the agenda Otherwise, the Board s action on the motion for approval which failed will-remain in effect and we will impose the one year time constraint, .- FUNDING SOURCE: , ATTACHMENTS:.. ' letter ,. , ~ . :. : ITEM-DOES NOT REQUIRE REVIEW " COUNTY. MANAGER'S COMMENTS AND RECOMMENDATIONS: - '~ ~. ;° Recommend. the consider remanding the zoning request back to the Planning Board for ~ , conside~rati , COMMISSIONERS' ACTIONS/COMMENTS: • Ct7UNTY COMMISStt1 • ' ` APPROVED p~_ REJECTED p ;: ~ ~ REMOVEp p POSTppN~t~ ~. • FtERftp ~ , ., - . ~ .. _ _. . A~~~ ,~,,„~~ Wye . ,- , .. .. . V~7~J{.3Yi V~~S7~~. ~4~~~~tt~gD~~p~~V~ ~.~~ ~' k ` ~ ~ - - - - ~' ~ -and the possibility. of establishing a County Drainage Department, it was the consensus of .` .. the Board to direct staff to prepare a -plan to address the six categories listed in the ' • Comprehensive Stormwater'Management Program with estimated.-costs and to develop a . `structure for appointment of drainage committees in specific areas comprised of County °representatives, development, businesses, and neighborhood property owners to be charged ' with addressing drainage concerns for a particular area. The plan is to be presented to the `Board at, the first meeting in October. . - .~ - _ 7. ' Consideration of Zoning Change for Library Property on Military-Cutoff: After - discussion of surrounding business .and office uses, it was the consensus of the Board to ~. direct the County Planning Office to initiate a zoning. petition to rezone~the library site to O-I Office .and Institution. • `.Public Hearings:.- .. . ~ .. 7.1 Rezoning, Appealed Case -Request by Rudie Malpass to rezone 1.72 acres at 649 Piner Road to O-I Office and' Institution from R-15 residential (Z-633; S/98): Motion: Commissioner Howell made a motion to approve the O-I' Office and Institution ` rezoning petition, No second was received on the motion. ' ., ~ ~ ~ ~ Since no further Board action was taken, the current residential. zoning will remain unchanged... ., .. ... ~.. ~: -. -. , ... , . , . , .. _ . • ~ 72 Special Use Permit -Request by ABA Mini-Storage,' Inc. to Provide an On-Site : , Manager's Residence for the Facility Located on the East Side of Carolina Beach Road ' West of Sander Road: Commissioner Howell requested to be recused from voting on this. . ~ issue because of a business relationship. 'Motion: Vice-Chairman Greer moved, seconded by Commissioner Birzenieks to recuse , Commissioner Howell from voting on the special use permit. The motion carried by a 4 to , :. ~ ~ 0 vote, ,- .. ' '>` Motion: After hearing the evidence and concluding the findings of fact inet the four general, requirements; Commissioner Birzenieks mo~~ed, seconded by Commissioner Howell to grant the special use permit to ABA Mini-Storage, Inc. to provide an on-site manager's residence ~at the facility located on Carolina Beach Road. The motion carried by a 4 to 0 vote. .' ~~7:3 ~ecial Use Permit- Request by Bonnie McGhee toLocate aSingle-Wide Mobile Home a ~' at 3227 Belt Road Zoned R=20 Residential (S-432, 9/98) Motion: After hearing the evidence and concluding the findings of fact met the four general 'requirements, Vice=Chairman Greer moved, seconded byCommissioner Birzenieks to-grant L